StarFunc result for job id Q07864

User Input

>input (2286 residues)
MSLRSGGRRRADPGADGEASRDDGATSSVSALKRLERSQWTDKMDLRFGFERLKEPGEKT
GWLINMHPTEILDEDKRLGSAVDYYFIQDDGSRFKVALPYKPYFYIATRKGCEREVSSFL
SKKFQGKIAKVETVPKEDLDLPNHLVGLKRNYIRLSFHTVEDLVKVRKEISPAVKKNREQ
DHASDAYTALLSSVLQRGGVITDEEETSKKIADQLDNIVDMREYDVPYHIRLSIDLKIHV
AHWYNVRYRGNAFPVEITRRDDLVERPDPVVLAFDIETTKLPLKFPDAETDQIMMISYMI
DGQGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFNEPDEAHLIQRWFEHVQETKPTIMV
TYNGDFFDWPFVEARAAVHGLSMQQEIGFQKDSQGEYKAPQCIHMDCLRWVKRDSYLPVG
SHNLKAAAKAKLGYDPVELDPEDMCRMATEQPQTLATYSVSDAVATYYLYMKYVHPFIFA
LCTIIPMEPDEVLRKGSGTLCEALLMVQAFHANIIFPNKQEQEFNKLTDDGHVLDSETYV
GGHVEALESGVFRSDIPCRFRMNPAAFDFLLQRVEKTLRHALEEEEKVPVEQVTNFEEVC
DEIKSKLASLKDVPSRIECPLIYHLDVGAMYPNIILTNRLQPSAMVDEATCAACDFNKPG
ANCQRKMAWQWRGEFMPASRSEYHRIQHQLESEKFPPLFPEGPARAFHELSREEQAKYEK
RRLADYCRKAYKKIHITKVEERLTTICQRENSFYVDTVRAFRDRRYEFKGLHKVWKKKLS
AAVEVGDAAEVKRCKNMEVLYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGIVCFTGA
NIITQARELIEQIGRPLELDTDGIWCVLPNSFPENFVFKTTNVKKPKVTISYPGAMLNIM
VKEGFTNDQYQELAEPSSLTYVTRSENSIFFEVDGPYLAMILPASKEEGKKLKKRYAVFN
EDGSLAELKGFEVKRRGELQLIKIFQSSVFEAFLKGSTLEEVYGSVAKVADYWLDVLYSK
AANMPDSELFELISENRSMSRKLEDYGEQKSTSISTAKRLAEFLGDQMVKDAGLSCRYII
SRKPEGSPVTERAIPLAIFQAEPTVRKHFLRKWLKSSSLQDFDIRAILDWDYYIERLGSA
IQKIITIPAALQQVKNPVPRVKHPDWLHKKLLEKNDVYKQKKISELFTLEGRRQVTMAEA
SEDSPRPSAPDMEDFGLVKLPHPAAPVTVKRKRVLWESQEESQDLTPTVPWQEILGQPPA
LGTSQEEWLVWLRFHKKKWQLQARQRLARRKRQRLESAEGVLRPGAIRDGPATGLGSFLR
RTARSILDLPWQIVQISETSQAGLFRLWALVGSDLHCIRLSIPRVFYVNQRVAKAEEGAS
YRKVNRVLPRSNMVYNLYEYSVPEDMYQEHINEINAELSAPDIEGVYETQVPLLFRALVH
LGCVCVVNKQLVRHLSGWEAETFALEHLEMRSLAQFSYLEPGSIRHIYLYHHAQAHKALF
GIFIPSQRRASVFVLDTVRSNQMPSLGALYSAEHGLLLEKVGPELLPPPKHTFEVRAETD
LKTICRAIQRFLLAYKEERRGPTLIAVQSSWELKRLASEIPVLEEFPLVPICVADKINYG
VLDWQRHGARRMIRHYLNLDTCLSQAFEMSRYFHIPIGNLPEDISTFGSDLFFARHLQRH
NHLLWLSPTARPDLGGKEADDNCLVMEFDDQATVEINSSGCYSTVCVELDLQNLAVNTIL
QSHHVNDMEGADSMGISFDVIQQASLEDMITGGQAASAPASYDETALCSNTFRILKSMVV
GWVKEITQYHNIYADNQVMHFYRWLRSPSSLLHDPALHRTLHNMMKKLFLQLIAEFKRLG
SSVIYANFNRIILCTKKRRVEDAIAYVEYITSSIHSKETFHSLTISFSRCWEFLLWMDPS
NYGGIKGKVSSRIHCGLQDSQKAGGAEDEQENEDDEEERDGEEEEEAEESNVEDLLENNW
NILQFLPQAASCQNYFLMIVSAYIVAVYHCMKDGLRRSAPGSTPVRRRGASQLSQEAEGA
VGALPGMITFSQDYVANELTQSFFTITQKIQKKVTGSRNSTELSEMFPVLPGSHLLLNNP
ALEFIKYVCKVLSLDTNITNQVNKLNRDLLRLVDVGEFSEEAQFRDPCRSYVLPEVICRS
CNFCRDLDLCKDSSFSEDGAVLPQWLCSNCQAPYDSSAIEMTLVEVLQKKLMAFTLQDLV
CLKCRGVKETSMPVYCSCAGDFALTIHTQVFMEQIGIFRNIAQHYGMSYLLETLEWLLQK
NPQLGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6wjvA	0.463	0.541	0.000	1951	0.371	0.434	6wjvA.pdb.gz
2	AFDB:F4HW04	0.788	0.831	0.000	2161	0.413	0.437	F4HW04.pdb.gz	DPOE1_ARATH DNA polymerase epsilon catalytic subunit A OS=Arabidopsis thaliana OX=3702 GN=POL2A PE=1 SV=1
3	AFDB:P21951	0.800	0.822	0.000	2222	0.398	0.409	P21951.pdb.gz	DPOE_YEAST DNA polymerase epsilon catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POL2 PE=1 SV=1
4	AFDB:P87154	0.778	0.807	0.000	2199	0.420	0.437	P87154.pdb.gz	DPOE_SCHPO DNA polymerase epsilon catalytic subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pol2 PE=1 SV=1
5	AFDB:Q07864	1.000	1.000	0.000	2286	1.000	1.000	Q07864.pdb.gz	DPOE1_HUMAN DNA polymerase epsilon catalytic subunit A OS=Homo sapiens OX=9606 GN=POLE PE=1 SV=5
6	AFDB:Q38DX2	0.474	0.482	0.000	2246	0.366	0.372	Q38DX2.pdb.gz	Q38DX2_TRYB2 DNA polymerase epsilon catalytic subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1820 PE=3 SV=1
7	AFDB:Q6FNY7	0.781	0.803	0.000	2217	0.395	0.407	Q6FNY7.pdb.gz	DPOE_CANGA DNA polymerase epsilon catalytic subunit A OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=POL2 PE=3 SV=1
8	AFDB:Q9VCN1	0.827	0.845	0.000	2236	0.548	0.560	Q9VCN1.pdb.gz	DPOE1_DROME DNA polymerase epsilon catalytic subunit 1 OS=Drosophila melanogaster OX=7227 GN=PolE1 PE=1 SV=3
9	PDB:7pmkQ	0.315	0.903	3.012E-44	766	0.089	0.266	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
10	PDB:7qhsG	0.301	0.867	1.520E-39	756	0.089	0.270	7qhsG.pdb.gz	Mechanism of replication origin melting nucleated by CMG helicase assembly.
11	PDB:7pfoB	0.205	0.539	1.185E-34	759	0.211	0.636	7pfoB.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.
12	PDB:7lufB	0.300	0.610	3.413E-28	1054	0.075	0.163	7lufB.pdb.gz	Structural understanding of non-nucleoside inhibition in an elongating herpesvirus polymerase.
13	PDB:7kc0A	0.296	0.631	5.507E-28	1004	0.072	0.164	7kc0A.pdb.gz	Structure of eukaryotic DNA polymerase delta bound to the PCNA clamp while encircling DNA.
14	PDB:3k57A	0.281	0.763	1.437E-26	782	0.070	0.203	3k57A.pdb.gz	Structural insight into translesion synthesis by DNA Pol II
15	PDB:6s1mA	0.296	0.620	2.428E-25	1010	0.076	0.172	6s1mA.pdb.gz	Structure of the processive human Pol delta holoenzyme.
16	PDB:3k5nA	0.258	0.697	6.910E-24	759	0.065	0.195	3k5nA.pdb.gz	Structural insight into translesion synthesis by DNA Pol II.
17	PDB:1s5jA	0.237	0.665	8.992E-23	727	0.069	0.216	1s5jA.pdb.gz	Insights into DNA replication: the crystal structure of DNA polymerase B1 from the archaeon Sulfolobus solfataricus
18	AFDB:O95782	0.030	0.051	2.523E-2	977	0.029	0.068	O95782.pdb.gz	AP2A1_HUMAN AP-2 complex subunit alpha-1 OS=Homo sapiens OX=9606 GN=AP2A1 PE=1 SV=3
19	AFDB:Q06321	0.041	0.056	1.317E-1	1198	0.054	0.104	Q06321.pdb.gz	ATG26_YEAST Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG26 PE=1 SV=1
20	AFDB:Q95YF0	0.061	0.079	1.637E-1	1378	0.047	0.078	Q95YF0.pdb.gz	CLAP1_CAEEL Protein CLASP-1 OS=Caenorhabditis elegans OX=6239 GN=cls-1 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z8X4	0.0	4364	2283	0.914	0.915	D3Z8X4_RAT DNA polymerase epsilon catalytic subunit OS=Rattus norvegicus OX=10116 GN=Pole PE=1 SV=1
2	F4HW04	0.0	1670	2161	0.389	0.412	DPOE1_ARATH DNA polymerase epsilon catalytic subunit A OS=Arabidopsis thaliana OX=3702 GN=POL2A PE=1 SV=1
3	F5H1D6	0.0	4702	2259	0.988	1.000	F5H1D6_HUMAN DNA polymerase epsilon catalytic subunit OS=Homo sapiens OX=9606 GN=POLE PE=1 SV=1
4	P21951	0.0	1546	2222	0.371	0.381	DPOE_YEAST DNA polymerase epsilon catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POL2 PE=1 SV=1
5	P87154	0.0	1696	2199	0.385	0.400	DPOE_SCHPO DNA polymerase epsilon catalytic subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pol2 PE=1 SV=1
6	Q07864	0.0	4772	2286	1.000	1.000	DPOE1_HUMAN DNA polymerase epsilon catalytic subunit A OS=Homo sapiens OX=9606 GN=POLE PE=1 SV=5
7	Q38DX2	0.0	646	2246	0.142	0.144	Q38DX2_TRYB2 DNA polymerase epsilon catalytic subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1820 PE=3 SV=1
8	Q6FNY7	0.0	1660	2217	0.410	0.423	DPOE_CANGA DNA polymerase epsilon catalytic subunit A OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=POL2 PE=3 SV=1
9	Q9GV40	0.0	2488	2220	0.544	0.560	Q9GV40_DROME DNA polymerase epsilon catalytic subunit OS=Drosophila melanogaster OX=7227 GN=PolE1 PE=3 SV=1
10	Q9VCN1	0.0	2539	2236	0.553	0.565	DPOE1_DROME DNA polymerase epsilon catalytic subunit 1 OS=Drosophila melanogaster OX=7227 GN=PolE1 PE=1 SV=3
11	P30315	1.53e-06	56.2	1094	0.032	0.067	DPOD_PLAFK DNA polymerase delta catalytic subunit OS=Plasmodium falciparum (isolate K1 / Thailand) OX=5839 GN=POLD PE=1 SV=1
12	P46588	7.62e-06	53.9	1038	0.037	0.082	DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans OX=5476 GN=POL3 PE=3 SV=2
13	P18131	2.35e-05	52.4	984	0.027	0.062	DPOL_NPVAC DNA polymerase OS=Autographa californica nuclear polyhedrosis virus OX=46015 GN=POL PE=3 SV=2
14	O89042	1.15e-04	50.1	1451	0.031	0.050	DPOLA_RAT DNA polymerase alpha catalytic subunit (Fragment) OS=Rattus norvegicus OX=10116 GN=Pola1 PE=1 SV=1
15	P30316	1.27e-04	50.1	1086	0.031	0.066	DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pol3 PE=1 SV=2
16	P54358	7.35e-04	47.4	1092	0.014	0.029	DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster OX=7227 GN=PolD1 PE=1 SV=2
17	Q2KNE0	0.001	46.6	1105	0.028	0.059	Q2KNE0_DANRE DNA polymerase OS=Danio rerio OX=7955 GN=zgc:152688 PE=1 SV=1
18	P33609	0.002	45.8	1465	0.031	0.048	DPOLA_MOUSE DNA polymerase alpha catalytic subunit OS=Mus musculus OX=10090 GN=Pola1 PE=1 SV=2
19	P26811	0.003	45.4	882	0.021	0.056	DPOL1_SACS2 DNA polymerase 1 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=dpo1 PE=1 SV=2
20	A6NMQ1	0.005	44.7	1468	0.031	0.048	A6NMQ1_HUMAN DNA polymerase OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02177 APP_N	24	16.7	Amyloid A4 N-terminal heparin-binding
2	PF00136 DNA_pol_B	8e-11	53.0	DNA polymerase family B
3	PF03104 DNA_pol_B_exo1	2.9e-93	324.3	DNA polymerase family B, exonuclease domain
4	PF10108 DNA_pol_B_exo2	4.3e-05	34.8	Predicted 3'-5' exonuclease related to the exonuclease domain of PolB
5	PF08490 DUF1744	1.3e-143	490.1	Domain of unknown function (DUF1744)
6	PF13482 RNase_H_2	0.021	26.2	RNase_H superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322570

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216367	0.999	DNA polymerase epsilon subunit 2
2	9606.ENSP00000363286	0.999	DNA polymerase epsilon subunit 3
3	9606.ENSP00000368349	0.999	DNA polymerase alpha catalytic subunit
4	9606.ENSP00000406046	0.999	DNA polymerase delta catalytic subunit
5	9606.ENSP00000420176	0.999	DNA polymerase epsilon subunit 4
6	9606.ENSP00000216122	0.998	DNA replication licensing factor MCM5
7	9606.ENSP00000262105	0.998	DNA replication licensing factor MCM4
8	9606.ENSP00000265056	0.998	DNA replication licensing factor MCM2
9	9606.ENSP00000307288	0.998	DNA replication licensing factor MCM7
10	9606.ENSP00000265465	0.997	DNA polymerase alpha subunit B
11	9606.ENSP00000480987	0.997	DNA replication licensing factor MCM3
12	9606.ENSP00000405726	0.996	Cell division control protein 45 homolog
13	9606.ENSP00000262315	0.995	Chromosome transmission fidelity protein 18 homolog
14	9606.ENSP00000264156	0.995	DNA replication licensing factor MCM6
15	9606.ENSP00000234420	0.993	DNA mismatch repair protein Msh6
16	9606.ENSP00000351697	0.993	DNA polymerase zeta catalytic subunit
17	9606.ENSP00000233146	0.991	DNA mismatch repair protein Msh2
18	9606.ENSP00000484105	0.990	DNA primase large subunit
19	9606.ENSP00000480186	0.989	DNA polymerase delta subunit 2
20	9606.ENSP00000263274	0.988	DNA ligase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003887	1.000	DNA-directed DNA polymerase activity
GO:0003676	0.986	nucleic acid binding
GO:0003677	0.979	DNA binding
GO:0016787	0.748	hydrolase activity
GO:0004518	0.690	nuclease activity
GO:0004536	0.664	deoxyribonuclease activity
GO:0008408	0.647	3'-5' exonuclease activity
GO:0008296	0.608	3'-5'-DNA exonuclease activity
GO:0003682	0.451	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006259	0.989	DNA metabolic process
GO:0050896	0.963	response to stimulus
GO:0051716	0.947	cellular response to stimulus
GO:0033554	0.935	cellular response to stress
GO:0006974	0.931	cellular response to DNA damage stimulus
GO:0006281	0.895	DNA repair
GO:0007049	0.859	cell cycle
GO:0006260	0.783	DNA replication
GO:0034654	0.759	nucleobase-containing compound biosynthetic process
GO:0071897	0.740	DNA biosynthetic process
GO:0006261	0.451	DNA-templated DNA replication
GO:0065007	0.450	biological regulation
GO:0022402	0.440	cell cycle process
GO:0050789	0.437	regulation of biological process
GO:0000278	0.417	mitotic cell cycle
GO:0050794	0.392	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0032991	0.986	protein-containing complex
GO:0016020	0.984	membrane
GO:0005694	0.948	chromosome
GO:0005886	0.947	plasma membrane
GO:0140513	0.888	nuclear protein-containing complex
GO:1902494	0.882	catalytic complex
GO:1990234	0.849	transferase complex
GO:0140535	0.823	intracellular protein-containing complex
GO:0005737	0.780	cytoplasm
GO:0000228	0.753	nuclear chromosome
GO:0061695	0.715	transferase complex, transferring phosphorus-containing groups
GO:0042575	0.580	DNA polymerase complex
GO:0008622	0.460	epsilon DNA polymerase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.7	1.000	DNA-directed DNA polymerase.
EC:3.-.-.-	0.748	Hydrolases.
EC:3.1.-.-	0.690	Acting on ester bonds.
EC:3.1.11.-	0.608	Exodeoxyribonucleases producing 5'-phosphomonoesters.

[back to server]