StarFunc result for job id Q07912

User Input

>input (1038 residues)
MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLW
EAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCL
IGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNA
MHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGM
GYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPE
SLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDI
YNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRA
ENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPD
RIDELYLGNPMDPPDLLSVELSTSRPPQHLGGVKKPTYDPVSEDQDPLSSDFKRLGLRKP
GLPRGLWLAKPSARVPGTKASRGSGAEVTLIDFGEEPVVPALRPCAPSLAQLAMDACSLL
DETPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDFEICSINSTLVGAGVP
AGPSQGQTNYAFVPEQARPPPPLEDNLFLPPQGGGKPPSSAQTAEIFQALQQECMRQLQA
PAGSPAPSPSPGGDDKPQVPPRVPIPPRPTRPHVQLSPAPPGEEETSQWPGPASPPRVPP
REPLSPQGSRTPSPLVPPGSSPLPPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRA
GPCILPIVRDGKKVSSTHYYLLPERPSYLERYQRFLREAQSPEEPTPLPVPLLLPPPSTP
APAAPTATVRPMPQAALDPKANFSTNNSNPGARPPPPRATARLPQRGCPGDGPEAGRPAD
KIQMAMVHGVTTEECQAALQCHGWSVQRAAQYLKVEQLFGLGLRPRGECHKVLEMFDWNL
EQAGCHLLGSWGPAHHKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A499FJ16	0.384	0.368	0.000	1086	0.971	0.928	A0A499FJ16.pdb.gz	A0A499FJ16_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
2	AFDB:O54967	0.484	0.476	0.000	1055	0.940	0.925	O54967.pdb.gz	ACK1_MOUSE Activated CDC42 kinase 1 OS=Mus musculus OX=10090 GN=Tnk2 PE=1 SV=2
3	AFDB:Q10925	0.331	0.280	6.061E-46	1237	0.309	0.259	Q10925.pdb.gz	SID3_CAEEL Tyrosine-protein kinase sid-3 OS=Caenorhabditis elegans OX=6239 GN=sid-3 PE=1 SV=2
4	AFDB:E9PT20	0.239	0.217	3.536E-26	1143	0.206	0.187	E9PT20.pdb.gz	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
5	AFDB:P42684	0.235	0.207	6.568E-26	1182	0.196	0.172	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
6	AFDB:P09208	0.241	0.118	1.108E-22	2144	0.178	0.086	P09208.pdb.gz	INSR_DROME Insulin-like receptor OS=Drosophila melanogaster OX=7227 GN=InR PE=1 SV=3
7	PDB:4fl2A	0.234	0.429	8.724E-22	555	0.099	0.186	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
8	PDB:1k9aB	0.230	0.529	2.209E-21	441	0.092	0.218	1k9aB.pdb.gz
9	AFDB:Q8IWU2	0.237	0.167	5.313E-21	1503	0.195	0.134	Q8IWU2.pdb.gz	LMTK2_HUMAN Serine/threonine-protein kinase LMTK2 OS=Homo sapiens OX=9606 GN=LMTK2 PE=1 SV=2
10	AFDB:Q96Q04	0.240	0.174	2.140E-20	1460	0.217	0.154	Q96Q04.pdb.gz	LMTK3_HUMAN Serine/threonine-protein kinase LMTK3 OS=Homo sapiens OX=9606 GN=LMTK3 PE=1 SV=2
11	AFDB:Q6ZMQ8	0.228	0.174	2.916E-20	1374	0.212	0.160	Q6ZMQ8.pdb.gz	LMTK1_HUMAN Serine/threonine-protein kinase LMTK1 OS=Homo sapiens OX=9606 GN=AATK PE=1 SV=2
12	PDB:4k2rA	0.234	0.437	7.770E-20	551	0.090	0.169	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
13	PDB:2h8hA	0.230	0.522	1.685E-19	445	0.100	0.234	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	AFDB:Q80YE4	0.227	0.175	9.254E-19	1365	0.194	0.147	Q80YE4.pdb.gz	LMTK1_MOUSE Serine/threonine-protein kinase LMTK1 OS=Mus musculus OX=10090 GN=Aatk PE=1 SV=1
15	PDB:4eomC	0.226	0.781	4.380E-15	276	0.067	0.254	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:8dksA	0.204	0.686	4.856E-15	283	0.075	0.276	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
17	PDB:4btfA	0.218	0.517	1.053E-14	413	0.070	0.177	4btfA.pdb.gz
18	PDB:6s73A	0.227	0.831	1.053E-14	269	0.066	0.257	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
19	PDB:4zhxA	0.232	0.563	1.109E-14	409	0.065	0.164	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:6b1uA	0.231	0.520	1.764E-14	442	0.066	0.154	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A499FJ16	0.0	2019	1086	0.971	0.928	A0A499FJ16_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
2	A0A5F9ZGX5	0.0	2092	1055	1.000	0.984	A0A5F9ZGX5_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
3	A0A5F9ZHJ2	0.0	2103	1072	1.000	0.968	A0A5F9ZHJ2_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
4	A0A5F9ZHP4	0.0	2027	1008	0.971	1.000	A0A5F9ZHP4_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
5	A0A5F9ZI29	0.0	2105	1040	1.000	0.998	A0A5F9ZI29_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
6	C9J1X3	0.0	2026	1040	0.971	0.969	C9J1X3_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
7	O54967	0.0	1887	1055	0.944	0.929	ACK1_MOUSE Activated CDC42 kinase 1 OS=Mus musculus OX=10090 GN=Tnk2 PE=1 SV=2
8	Q07912	0.0	2107	1038	1.000	1.000	ACK1_HUMAN Activated CDC42 kinase 1 OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=3
9	Q17R13	0.0	1905	1039	0.948	0.947	ACK1_BOVIN Activated CDC42 kinase 1 OS=Bos taurus OX=9913 GN=TNK2 PE=1 SV=1
10	Q5U2X5	0.0	1865	1040	0.939	0.938	ACK1_RAT Activated CDC42 kinase 1 OS=Rattus norvegicus OX=10116 GN=Tnk2 PE=2 SV=1
11	Q9VZI2	4.87e-165	516	1073	0.244	0.236	ACK_DROME Activated Cdc42 kinase Ack OS=Drosophila melanogaster OX=7227 GN=Ack PE=1 SV=2
12	Q13470	2.11e-111	362	666	0.202	0.315	TNK1_HUMAN Non-receptor tyrosine-protein kinase TNK1 OS=Homo sapiens OX=9606 GN=TNK1 PE=1 SV=3
13	Q99ML2	2.65e-109	356	666	0.199	0.311	TNK1_MOUSE Non-receptor tyrosine-protein kinase TNK1 OS=Mus musculus OX=10090 GN=Tnk1 PE=1 SV=2
14	Q10925	3.34e-95	330	1237	0.191	0.160	SID3_CAEEL Tyrosine-protein kinase sid-3 OS=Caenorhabditis elegans OX=6239 GN=sid-3 PE=1 SV=2
15	Q9I7F7	6.17e-82	293	1337	0.187	0.145	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
16	G5EBZ8	1.82e-74	268	1043	0.159	0.158	ARK1_CAEEL Ack-related non-receptor tyrosine kinase OS=Caenorhabditis elegans OX=6239 GN=ark-1 PE=2 SV=1
17	Q66I04	1.48e-63	226	510	0.117	0.237	Q66I04_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=zgc:92124 PE=2 SV=1
18	Q62662	8.50e-60	215	506	0.117	0.239	FRK_RAT Tyrosine-protein kinase FRK OS=Rattus norvegicus OX=10116 GN=Frk PE=1 SV=3
19	P42685	1.64e-59	214	505	0.116	0.238	FRK_HUMAN Tyrosine-protein kinase FRK OS=Homo sapiens OX=9606 GN=FRK PE=1 SV=1
20	H0Y3C5	2.20e-58	212	525	0.100	0.198	H0Y3C5_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	73	13.9	ABC1 atypical kinase-like domain
2	PF09027 GTPase_binding	5.3e-26	101.7	GTPase binding
3	PF02954 HTH_8	7.3e+02	11.3	Bacterial regulatory protein, Fis family
4	PF11555 Inhibitor_Mig-6	3e-21	86.8	EGFR receptor inhibitor Mig-6
5	PF14531 Kinase-like	0.2	22.5	Kinase-like
6	PF00069 Pkinase	5.1e-38	142.5	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	1.3e-83	291.9	Protein tyrosine and serine/threonine kinase
8	PF07647 SAM_2	6.5e+02	11.9	SAM domain (Sterile alpha motif)
9	PF00018 SH3_1	0.27	22.2	SH3 domain
10	PF07653 SH3_2	4.8	18.4	Variant SH3 domain
11	PF14604 SH3_9	2.6e-08	45.0	Variant SH3 domain
12	PF14555 UBA_4	0.021	26.0	UBA-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005545309.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005544567.1	0.965	Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. Regulates the bipolar attachment of spindle microtubules to kinetochores before chromosome congression in metaphase. Regulates cell migration. In neurons, plays a role in the extension and maintenance of the formation of filopodia, thin and actin-rich surface projections (By similarity). Required for DOCK10-mediated spine formation in P [...]
2	9541.XP_005551797.1	0.965	Cell division control protein 42 homolog
3	9541.XP_005553184.1	0.965	Cell division control protein 42 homolog
4	9541.XP_005584984.1	0.928	Growth factor receptor-bound protein 2 isoform X1
5	9541.XP_005549616.1	0.892	Receptor protein-tyrosine kinase
6	9541.XP_005583928.1	0.854	Clathrin is the major protein of the polyhedral coat of coated pits and vesicles
7	9541.XP_005552254.1	0.847	Uncharacterized protein
8	9541.XP_005549554.1	0.789	Ras-related C3 botulinum toxin substrate 1
9	9541.XP_005567434.1	0.789	Uncharacterized protein
10	9541.XP_005585469.1	0.789	Uncharacterized protein
11	9541.XP_005569018.1	0.785	Neuronal proto-oncogene tyrosine-protein kinase Src isoform X1
12	9541.XP_005556949.1	0.767	Uncharacterized protein
13	9541.XP_005560176.1	0.767	Sorting nexin-33
14	9541.XP_005545915.1	0.754	Cytoplasmic protein NCK1 isoform X1
15	9541.XP_005575242.1	0.754	Cytoplasmic protein NCK2 isoform X1
16	9541.XP_005584091.1	0.745	Receptor protein-tyrosine kinase
17	9541.XP_005592619.1	0.728	Breast cancer anti-estrogen resistance protein 1 isoform X1
18	9541.XP_005586631.1	0.718	Neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
19	9541.XP_005559680.1	0.695	E3 ubiquitin-protein ligase NEDD4 isoform X1
20	9541.XP_005568050.1	0.684	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004713	0.999	protein tyrosine kinase activity
GO:0019904	0.971	protein domain specific binding
GO:0019899	0.824	enzyme binding
GO:0098772	0.717	molecular function regulator activity
GO:0030234	0.598	enzyme regulator activity
GO:0050699	0.595	WW domain binding
GO:0019900	0.335	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0050896	0.885	response to stimulus
GO:0048518	0.840	positive regulation of biological process
GO:0051716	0.831	cellular response to stimulus
GO:0048522	0.818	positive regulation of cellular process
GO:0007154	0.743	cell communication
GO:0023052	0.731	signaling
GO:0007165	0.690	signal transduction
GO:0044237	0.672	cellular metabolic process
GO:0071704	0.625	organic substance metabolic process
GO:0044238	0.623	primary metabolic process
GO:0032501	0.607	multicellular organismal process
GO:0006807	0.605	nitrogen compound metabolic process
GO:0019222	0.604	regulation of metabolic process
GO:0032502	0.603	developmental process
GO:0048856	0.565	anatomical structure development
GO:0043170	0.564	macromolecule metabolic process
GO:1901564	0.546	organonitrogen compound metabolic process
GO:0031323	0.482	regulation of cellular metabolic process
GO:0060255	0.477	regulation of macromolecule metabolic process
GO:0080090	0.470	regulation of primary metabolic process
GO:0051171	0.467	regulation of nitrogen compound metabolic process
GO:0051128	0.458	regulation of cellular component organization
GO:0048583	0.453	regulation of response to stimulus
GO:0009893	0.451	positive regulation of metabolic process
GO:0019538	0.428	protein metabolic process
GO:0031325	0.426	positive regulation of cellular metabolic process
GO:0048519	0.420	negative regulation of biological process
GO:0010604	0.417	positive regulation of macromolecule metabolic process
GO:0051173	0.403	positive regulation of nitrogen compound metabolic process
GO:0048523	0.400	negative regulation of cellular process
GO:0036211	0.342	protein modification process
GO:0051174	0.338	regulation of phosphorus metabolic process
GO:0019220	0.334	regulation of phosphate metabolic process
GO:0051247	0.322	positive regulation of protein metabolic process
GO:0031399	0.320	regulation of protein modification process
GO:0007166	0.320	cell surface receptor signaling pathway
GO:0023051	0.318	regulation of signaling
GO:0009966	0.307	regulation of signal transduction
GO:0071840	0.305	cellular component organization or biogenesis
GO:0042325	0.304	regulation of phosphorylation
GO:0016043	0.303	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.867	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.999	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]

[back to server]