StarFunc result for job id Q07954

User Input

>input (1400 residues)
MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGC
QHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYL
LQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANE
TVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDI
DDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTK
LVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFE
NYLYATNSDNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACEN
DQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRG
MDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDG
IHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNG
WMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFY
DRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGVGGAPPTVT
LLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGV
TCLANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRF
KCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDD
CGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQF
KCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRW
RCDGDTDCMDSSDEKSCEGVTHVCDPSVKFGCKDSARCISKAWVCDGDNDCEDNSDEENC
ESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAP
GEGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGES
CRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDK
IYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTT
LLAGDIEHPRAIALDPRDGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P98163	0.286	0.211	1.187E-95	1984	0.277	0.196	P98163.pdb.gz	YL_DROME Putative vitellogenin receptor OS=Drosophila melanogaster OX=7227 GN=yl PE=1 SV=2
2	AFDB:Q6X0I2	0.283	0.230	8.769E-95	1782	0.279	0.219	Q6X0I2.pdb.gz	VGR_SOLIN Vitellogenin receptor OS=Solenopsis invicta OX=13686 GN=VgR PE=2 SV=1
3	AFDB:O75096	0.411	0.308	4.921E-87	1905	0.266	0.195	O75096.pdb.gz	LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens OX=9606 GN=LRP4 PE=1 SV=4
4	AFDB:Q9VXM0	0.411	0.298	7.403E-84	2009	0.239	0.167	Q9VXM0.pdb.gz	Q9VXM0_DROME LDL receptor related protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Lrp4 PE=4 SV=1
5	AFDB:A0A140LH43	0.256	0.299	9.643E-76	1190	0.267	0.314	A0A140LH43.pdb.gz
6	AFDB:O75197	0.376	0.329	2.765E-71	1615	0.212	0.184	O75197.pdb.gz	LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens OX=9606 GN=LRP5 PE=1 SV=2
7	AFDB:F1QTJ4	0.376	0.330	7.130E-71	1615	0.209	0.181	F1QTJ4.pdb.gz	F1QTJ4_DANRE Low density lipoprotein receptor-related protein 5 OS=Danio rerio OX=7955 GN=LRP6 PE=1 SV=1
8	AFDB:A0A0G2K0H3	0.372	0.327	1.031E-70	1613	0.206	0.179	A0A0G2K0H3.pdb.gz	A0A0G2K0H3_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp6 PE=3 SV=1
9	AFDB:A1Z9D7	0.358	0.305	4.050E-70	1678	0.202	0.169	A1Z9D7.pdb.gz	A1Z9D7_DROME Low-density lipoprotein receptor-related protein OS=Drosophila melanogaster OX=7227 GN=arr PE=2 SV=1
10	AFDB:F1M443	0.163	0.273	9.914E-66	752	0.251	0.467	F1M443.pdb.gz	F1M443_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=4
11	PDB:7mq8LR	0.150	0.251	1.096E-15	773	0.046	0.084	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mqaLQ	0.172	0.263	5.043E-15	830	0.044	0.075	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7ajuUL	0.188	0.308	6.562E-15	779	0.047	0.085	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:5wyjBA	0.160	0.274	8.208E-14	755	0.043	0.079	5wyjBA.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
15	PDB:7ajtUA	0.161	0.257	1.013E-13	834	0.046	0.077	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7d5sB2	0.163	0.252	3.777E-13	851	0.047	0.078	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
17	PDB:7mqaLO	0.169	0.262	4.423E-13	819	0.049	0.083	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7mq8LT	0.144	0.219	6.065E-13	869	0.053	0.085	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:6lqsB1	0.160	0.261	6.393E-13	806	0.040	0.069	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
20	PDB:7mq8LO	0.118	0.187	6.739E-13	848	0.046	0.077	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KFD1	661	4752	0.329	0.097	A0A0B4KFD1_DROME LDL receptor protein 1, isoform F OS=Drosophila melanogaster OX=7227 GN=LRP1 PE=1 SV=1
2	A0A8I6AQY2	1730	4469	0.583	0.183	A0A8I6AQY2_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=1
3	A1Z7C4	662	4730	0.329	0.097	A1Z7C4_DROME LDL receptor protein 1, isoform G OS=Drosophila melanogaster OX=7227 GN=LRP1 PE=1 SV=2
4	A2ARV4	849	4660	0.380	0.114	LRP2_MOUSE Low-density lipoprotein receptor-related protein 2 OS=Mus musculus OX=10090 GN=Lrp2 PE=1 SV=1
5	A8JTM7	736	4769	0.364	0.107	A8JTM7_DROME Megalin, isoform A OS=Drosophila melanogaster OX=7227 GN=mgl PE=1 SV=2
6	C0HL13	831	4652	0.364	0.110	LRP2_PIG Low-density lipoprotein receptor-related protein 2 OS=Sus scrofa OX=9823 GN=LRP2 PE=1 SV=1
7	E0AE56	868	4673	0.369	0.111	E0AE56_DANRE Low-density lipoprotein receptor-related protein 2 OS=Danio rerio OX=7955 GN=lrp2 PE=1 SV=1
8	E1BGJ0	2853	4545	0.984	0.303	E1BGJ0_BOVIN LDL receptor related protein 1 OS=Bos taurus OX=9913 GN=LRP1 PE=1 SV=3
9	F1M443	1730	4436	0.583	0.184	F1M443_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=4
10	F1QY34	2324	4549	0.782	0.241	F1QY34_DANRE Low density lipoprotein receptor-related protein 1Ab OS=Danio rerio OX=7955 GN=lrp1ab PE=1 SV=1
11	G3V928	2841	4545	0.982	0.303	LRP1_RAT Prolow-density lipoprotein receptor-related protein 1 OS=Rattus norvegicus OX=10116 GN=Lrp1 PE=1 SV=1
12	P98158	847	4660	0.377	0.113	LRP2_RAT Low-density lipoprotein receptor-related protein 2 OS=Rattus norvegicus OX=10116 GN=Lrp2 PE=1 SV=1
13	P98164	832	4655	0.366	0.110	LRP2_HUMAN Low-density lipoprotein receptor-related protein 2 OS=Homo sapiens OX=9606 GN=LRP2 PE=1 SV=3
14	Q04833	624	4753	0.338	0.100	LRP_CAEEL Low-density lipoprotein receptor-related protein OS=Caenorhabditis elegans OX=6239 GN=lrp-1 PE=1 SV=1
15	Q07954	2893	4544	1.000	0.308	LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2
16	Q7Z5C0	832	4655	0.366	0.110	Q7Z5C0_HUMAN Glycoprotein receptor gp330/megalin OS=Homo sapiens OX=9606 PE=2 SV=1
17	Q7Z5C1	830	4655	0.365	0.110	Q7Z5C1_HUMAN Glycoprotein receptor gp330/megalin OS=Homo sapiens OX=9606 PE=2 SV=1
18	Q91ZX7	2847	4545	0.984	0.303	LRP1_MOUSE Prolow-density lipoprotein receptor-related protein 1 OS=Mus musculus OX=10090 GN=Lrp1 PE=1 SV=1
19	Q9JI18	1825	4599	0.616	0.187	LRP1B_MOUSE Low-density lipoprotein receptor-related protein 1B OS=Mus musculus OX=10090 GN=Lrp1b PE=1 SV=1
20	Q9NZR2	1818	4599	0.632	0.192	LRP1B_HUMAN Low-density lipoprotein receptor-related protein 1B OS=Homo sapiens OX=9606 GN=LRP1B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	1.7e-11	55.1	Complement Clr-like EGF-like
2	PF07645 EGF_CA	0.031	25.8	Calcium-binding EGF domain
3	PF14670 FXa_inhibition	9.5e-28	107.6	Coagulation Factor Xa inhibitory site
4	PF00057 Ldl_recept_a	3.4e-103	348.8	Low-density lipoprotein receptor domain class A
5	PF00058 Ldl_recept_b	2.8e-52	186.2	Low-density lipoprotein receptor repeat class B
6	PF11468 PTase_Orf2	77	14.1	Aromatic prenyltransferase Orf2
7	PF08450 SGL	0.00015	33.0	SMP-30/Gluconolactonase/LRE-like region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243077

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220809	0.999	Tissue-type plasminogen activator
2	9606.ENSP00000223095	0.999	Plasminogen activator inhibitor 1
3	9606.ENSP00000252486	0.999	Apolipoprotein E
4	9606.ENSP00000339328	0.998	Urokinase plasminogen activator surface receptor
5	9606.ENSP00000323929	0.997	Alpha-2-macroglobulin
6	9606.ENSP00000320866	0.994	Calreticulin
7	9606.ENSP00000421922	0.994	Alpha-2-macroglobulin receptor-associated protein
8	9606.ENSP00000265983	0.993	Hemopexin
9	9606.ENSP00000309757	0.993	Lipoprotein lipase
10	9606.ENSP00000401303	0.993	SHC-transforming protein 1
11	9606.ENSP00000284981	0.992	Amyloid-beta A4 protein
12	9606.ENSP00000299767	0.992	Endoplasmin
13	9606.ENSP00000302961	0.987	Heat shock protein family A member 4
14	9606.ENSP00000382428	0.987	Disks large homolog 4
15	9606.ENSP00000361850	0.986	Urokinase-type plasminogen activator
16	9606.ENSP00000261799	0.984	Platelet-derived growth factor receptor beta
17	9606.ENSP00000260356	0.981	Thrombospondin-1
18	9606.ENSP00000477213	0.973	Amyloid-beta A4 precursor protein-binding family B member 1
19	9606.ENSP00000052754	0.972	Decorin
20	9606.ENSP00000335153	0.969	Heat shock protein HSP 90-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0038024	0.623	cargo receptor activity
GO:0030228	0.579	lipoprotein particle receptor activity
GO:0005041	0.408	low-density lipoprotein particle receptor activity
GO:0071813	0.368	lipoprotein particle binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.899	biological regulation
GO:0050789	0.888	regulation of biological process
GO:0050794	0.843	regulation of cellular process
GO:0060627	0.820	regulation of vesicle-mediated transport
GO:0032501	0.805	multicellular organismal process
GO:0048519	0.792	negative regulation of biological process
GO:0006898	0.786	receptor-mediated endocytosis
GO:0051050	0.776	positive regulation of transport
GO:0032502	0.699	developmental process
GO:0030100	0.674	regulation of endocytosis
GO:0051239	0.635	regulation of multicellular organismal process
GO:0065009	0.573	regulation of molecular function
GO:0009987	0.570	cellular process
GO:0048856	0.301	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005886	0.990	plasma membrane
GO:0005622	0.946	intracellular anatomical structure
GO:0043227	0.928	membrane-bounded organelle
GO:0005737	0.915	cytoplasm
GO:0043229	0.885	intracellular organelle
GO:0043231	0.869	intracellular membrane-bounded organelle
GO:0031982	0.691	vesicle
GO:0012505	0.671	endomembrane system
GO:0009986	0.500	cell surface
GO:0031410	0.327	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]