StarFunc result for job id Q07955

User Input

>input (248 residues)
MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVE
FEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSE
NRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKF
RSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPR
HSRSRSRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A9L2	0.752	0.752	7.376E-46	248	1.000	1.000	D4A9L2.pdb.gz	D4A9L2_RAT Serine/arginine-rich splicing factor 1 OS=Rattus norvegicus OX=10116 GN=Srsf1 PE=1 SV=1
2	AFDB:Q9V3W7	0.665	0.648	7.255E-33	255	0.641	0.624	Q9V3W7.pdb.gz	Q9V3W7_DROME LD40489p OS=Drosophila melanogaster OX=7227 GN=SF2 PE=1 SV=1
3	AFDB:Q13242	0.640	0.712	1.210E-31	221	0.649	0.729	Q13242.pdb.gz	SRSF9_HUMAN Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1
4	AFDB:Q9NEW6	0.491	0.476	8.572E-31	258	0.613	0.589	Q9NEW6.pdb.gz	RSP3_CAEEL Probable splicing factor, arginine/serine-rich 3 OS=Caenorhabditis elegans OX=6239 GN=rsp-3 PE=1 SV=2
5	AFDB:A2RVS6	0.609	0.515	5.082E-27	300	0.581	0.480	A2RVS6.pdb.gz	SR34A_ARATH Serine/arginine-rich splicing factor SR34A OS=Arabidopsis thaliana OX=3702 GN=SR34A PE=2 SV=1
6	AFDB:O22315	0.613	0.511	2.207E-26	303	0.585	0.479	O22315.pdb.gz	SR34_ARATH Serine/arginine-rich-splicing factor SR34 OS=Arabidopsis thaliana OX=3702 GN=SR34 PE=1 SV=1
7	AFDB:Q9XFR5	0.605	0.565	9.797E-25	268	0.520	0.481	Q9XFR5.pdb.gz	SR30_ARATH Serine/arginine-rich splicing factor SR30 OS=Arabidopsis thaliana OX=3702 GN=SR30 PE=1 SV=1
8	AFDB:Q8I3T5	0.387	0.329	1.699E-24	298	0.484	0.403	Q8I3T5.pdb.gz	Q8I3T5_PLAF7 Serine/arginine-rich splicing factor 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0517300 PE=1 SV=2
9	AFDB:Q8IJI0	0.328	0.162	1.546E-20	538	0.379	0.175	Q8IJI0.pdb.gz	Q8IJI0_PLAF7 Serine/arginine-rich splicing factor 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1022400 PE=4 SV=1
10	AFDB:Q802Y1	0.304	0.216	6.313E-20	366	0.452	0.306	Q802Y1.pdb.gz	Q802Y1_DANRE Serine and arginine-rich-splicing factor 4 OS=Danio rerio OX=7955 GN=zgc:55809 PE=1 SV=1
11	PDB:7abgA6	0.290	0.944	3.444E-12	74	0.294	0.986	7abgA6.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
12	PDB:7oqcF	0.277	0.259	7.338E-11	267	0.153	0.142	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
13	PDB:6y5qq	0.283	0.386	1.878E-9	178	0.137	0.191	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:5vsuA	0.291	0.195	3.064E-9	387	0.109	0.070	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
15	PDB:7evoD	0.296	0.364	8.670E-9	200	0.161	0.200	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
16	PDB:6y53o	0.304	0.449	2.772E-8	160	0.125	0.194	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
17	PDB:6ff7X	0.289	0.409	2.219E-7	171	0.113	0.164	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:5lsbA	0.302	0.413	3.621E-7	176	0.121	0.170	5lsbA.pdb.gz
19	PDB:3lqvB	0.288	0.601	8.527E-7	115	0.113	0.243	3lqvB.pdb.gz	Branch Recognition by SF3b14
20	PDB:6qx91K	0.310	0.378	1.671E-6	201	0.125	0.154	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A9L2	3.81e-174	481	248	1.000	1.000	D4A9L2_RAT Serine/arginine-rich splicing factor 1 OS=Rattus norvegicus OX=10116 GN=Srsf1 PE=1 SV=1
2	Q07955	3.81e-174	481	248	1.000	1.000	SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2
3	Q6PDM2	3.81e-174	481	248	1.000	1.000	SRSF1_MOUSE Serine/arginine-rich splicing factor 1 OS=Mus musculus OX=10090 GN=Srsf1 PE=1 SV=3
4	A0A8I6GMR8	5.63e-173	478	253	0.992	0.972	A0A8I6GMR8_RAT Serine/arginine-rich splicing factor 1 OS=Rattus norvegicus OX=10116 GN=Srsf1 PE=1 SV=1
5	Q5PPI1	1.95e-88	263	221	0.633	0.710	SRSF9_RAT Serine/arginine-rich splicing factor 9 OS=Rattus norvegicus OX=10116 GN=Srsf9 PE=1 SV=1
6	Q9V3W7	2.07e-83	251	255	0.512	0.498	Q9V3W7_DROME LD40489p OS=Drosophila melanogaster OX=7227 GN=SF2 PE=1 SV=1
7	Q13242	7.38e-83	248	221	0.540	0.606	SRSF9_HUMAN Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1
8	Q9NEW6	4.56e-65	204	258	0.528	0.508	RSP3_CAEEL Probable splicing factor, arginine/serine-rich 3 OS=Caenorhabditis elegans OX=6239 GN=rsp-3 PE=1 SV=2
9	Q9XFR5	3.12e-59	190	268	0.415	0.384	SR30_ARATH Serine/arginine-rich splicing factor SR30 OS=Arabidopsis thaliana OX=3702 GN=SR30 PE=1 SV=1
10	O22315	2.03e-55	181	303	0.419	0.343	SR34_ARATH Serine/arginine-rich-splicing factor SR34 OS=Arabidopsis thaliana OX=3702 GN=SR34 PE=1 SV=1
11	A2RVS6	4.38e-53	175	300	0.440	0.363	SR34A_ARATH Serine/arginine-rich splicing factor SR34A OS=Arabidopsis thaliana OX=3702 GN=SR34A PE=2 SV=1
12	Q8I3T5	8.73e-52	172	298	0.371	0.309	Q8I3T5_PLAF7 Serine/arginine-rich splicing factor 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0517300 PE=1 SV=2
13	Q8IJI0	1.37e-36	137	538	0.319	0.147	Q8IJI0_PLAF7 Serine/arginine-rich splicing factor 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1022400 PE=4 SV=1
14	Q8VE97	1.58e-35	134	489	0.315	0.160	SRSF4_MOUSE Serine/arginine-rich splicing factor 4 OS=Mus musculus OX=10090 GN=Srsf4 PE=2 SV=1
15	G3V798	2.74e-35	133	488	0.315	0.160	G3V798_RAT Serine and arginine rich splicing factor 4 OS=Rattus norvegicus OX=10116 GN=Srsf4 PE=4 SV=1
16	Q08170	3.67e-35	132	494	0.315	0.158	SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2
17	O35326	2.03e-31	118	269	0.315	0.290	SRSF5_MOUSE Serine/arginine-rich splicing factor 5 OS=Mus musculus OX=10090 GN=Srsf5 PE=1 SV=2
18	Q09167	2.03e-31	118	269	0.315	0.290	SRSF5_RAT Serine/arginine-rich splicing factor 5 OS=Rattus norvegicus OX=10116 GN=Srsf5 PE=1 SV=1
19	P26686	2.10e-31	120	376	0.315	0.207	SRR55_DROME Serine-arginine protein 55 OS=Drosophila melanogaster OX=7227 GN=B52 PE=1 SV=4
20	Q13243	2.17e-31	118	272	0.315	0.287	SRSF5_HUMAN Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00937 CoV_nucleocap	1.2e+02	13.2	Coronavirus nucleocapsid
2	PF01609 DDE_Tnp_1	18	16.4	Transposase DDE domain
3	PF14605 Nup35_RRM_2	8.9	17.7	Nup53/35/40-type RNA recognition motif
4	PF00076 RRM_1	9.7e-31	116.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
5	PF08777 RRM_3	1.8	20.0	RNA binding motif
6	PF16367 RRM_7	12	17.4	RNA recognition motif
7	PF16842 RRM_occluded	0.9	20.8	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010618541.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010622511.1	0.999	Transformer-2 protein homolog beta
2	885580.XP_010617027.1	0.993	Serine/arginine-rich splicing factor 2
3	885580.XP_010626562.1	0.991	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
4	885580.XP_010603703.1	0.990	Serine/threonine-protein kinase SRPK1
5	885580.XP_010639191.1	0.990	U1 small nuclear ribonucleoprotein 70 kDa
6	885580.XP_010634907.1	0.986	Splicing factor U2AF 35 kDa subunit
7	885580.XP_010637008.1	0.986	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through non-specific electrostatic contacts with RNA
8	885580.XP_010607954.1	0.982	Small nuclear ribonucleoprotein G isoform X1
9	885580.XP_010627472.1	0.981	Small nuclear ribonucleoprotein F
10	885580.XP_010631979.1	0.981	Serine/arginine repetitive matrix protein 1 isoform X1
11	885580.XP_010642740.1	0.981	Splicing factor 3B subunit 3
12	885580.XP_010643325.1	0.981	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing. May indirectly play a role in hair development.
13	885580.XP_010612902.1	0.980	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome.
14	885580.XP_010637127.1	0.979	Serine/arginine-rich splicing factor 3
15	885580.XP_010615331.1	0.976	Necessary for the splicing of pre-mRNA.
16	885580.XP_010603269.1	0.975	Serine/arginine-rich splicing factor 7 isoform X1
17	885580.XP_010616942.1	0.970	THO complex subunit 4
18	885580.XP_010631273.1	0.969	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
19	885580.XP_010602210.1	0.963	Small nuclear ribonucleoprotein Sm D3
20	885580.XP_010626413.1	0.961	TAR DNA-binding protein 43 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0019899	0.997	enzyme binding
GO:0003729	0.989	mRNA binding
GO:0019900	0.692	kinase binding
GO:0019901	0.320	protein kinase binding
GO:0043422	0.306	protein kinase B binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0010467	0.990	gene expression
GO:0090304	0.988	nucleic acid metabolic process
GO:0050794	0.980	regulation of cellular process
GO:0006396	0.980	RNA processing
GO:0008380	0.969	RNA splicing
GO:0060255	0.939	regulation of macromolecule metabolic process
GO:0010468	0.920	regulation of gene expression
GO:0000375	0.919	RNA splicing, via transesterification reactions
GO:0032502	0.918	developmental process
GO:0080090	0.917	regulation of primary metabolic process
GO:0051171	0.917	regulation of nitrogen compound metabolic process
GO:0031323	0.916	regulation of cellular metabolic process
GO:0000398	0.909	mRNA splicing, via spliceosome
GO:0019219	0.907	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.898	regulation of RNA metabolic process
GO:0043484	0.889	regulation of RNA splicing
GO:0048518	0.692	positive regulation of biological process
GO:0032501	0.626	multicellular organismal process
GO:0048856	0.599	anatomical structure development
GO:0000380	0.549	alternative mRNA splicing, via spliceosome
GO:0048522	0.478	positive regulation of cellular process
GO:0010604	0.456	positive regulation of macromolecule metabolic process
GO:0010628	0.340	positive regulation of gene expression
GO:0050896	0.327	response to stimulus
GO:0048519	0.315	negative regulation of biological process
GO:0071840	0.303	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.937	cytoplasm
GO:0032991	0.850	protein-containing complex
GO:0140513	0.561	nuclear protein-containing complex
GO:1990904	0.438	ribonucleoprotein complex
GO:0005681	0.376	spliceosomal complex
GO:0016607	0.369	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]