StarFunc result for job id Q07973

User Input

>input (514 residues)
MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPG
PTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYR
TESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKIN
EVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIM
AIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSAD
FLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVL
PENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQ
VLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIV
RKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07973	1.000	1.000	2.914E-82	514	1.000	1.000	Q07973.pdb.gz	CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP24A1 PE=1 SV=2
2	AFDB:Q09128	0.923	0.923	4.295E-69	514	0.831	0.831	Q09128.pdb.gz	CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp24a1 PE=1 SV=1
3	AFDB:O73684	0.908	0.918	2.729E-63	508	0.673	0.681	O73684.pdb.gz	O73684_CHICK 25-hydroxyvitamin D3 24-hydroxylase OS=Gallus gallus OX=9031 GN=cP450cc24 PE=2 SV=1
4	PDB:3k9vA	0.888	0.983	2.289E-62	464	0.774	0.858	3k9vA.pdb.gz	Crystal structure of CYP24A1, a mitochondrial cytochrome P450 involved in vitamin D metabolism.
5	AFDB:A0A140LGN8	0.858	0.872	1.459E-37	506	0.327	0.332	A0A140LGN8.pdb.gz
6	AFDB:Q4G0S4	0.835	0.793	2.806E-37	542	0.315	0.299	Q4G0S4.pdb.gz	C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens OX=9606 GN=CYP27C1 PE=1 SV=3
7	AFDB:O35084	0.838	0.849	3.544E-37	507	0.302	0.306	O35084.pdb.gz	CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27b1 PE=1 SV=2
8	AFDB:O15528	0.840	0.849	1.818E-36	508	0.325	0.329	O15528.pdb.gz	CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27B1 PE=1 SV=1
9	AFDB:Q9DBG1	0.830	0.802	1.905E-36	533	0.329	0.317	Q9DBG1.pdb.gz	CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27a1 PE=1 SV=1
10	AFDB:P17178	0.853	0.824	4.024E-36	533	0.309	0.298	P17178.pdb.gz	CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp27a1 PE=1 SV=1
11	AFDB:Q02318	0.829	0.803	3.250E-34	531	0.311	0.301	Q02318.pdb.gz	CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27A1 PE=1 SV=1
12	PDB:3na1A	0.826	0.896	5.608E-31	472	0.274	0.299	3na1A.pdb.gz	Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.
13	PDB:3mzsA	0.823	0.895	2.355E-29	470	0.257	0.281	3mzsA.pdb.gz	Structural Basis for Three-step Sequential Catalysis by the Cholesterol Side Chain Cleavage Enzyme CYP11A1.
14	PDB:7m8iA	0.792	0.716	3.586E-29	572	0.255	0.229	7m8iA.pdb.gz	Structural and functional insights into aldosterone synthase interaction with its redox partner protein adrenodoxin.
15	PDB:7mk8B	0.749	0.823	2.587E-22	465	0.208	0.230	7mk8B.pdb.gz	Structural Basis for the Diminished Ligand Binding and Catalytic Ability of Human Fetal-Specific CYP3A7.
16	PDB:5veuC	0.752	0.820	2.710E-22	469	0.226	0.247	5veuC.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
17	PDB:5te8B	0.761	0.826	2.976E-22	471	0.235	0.257	5te8B.pdb.gz	Structural basis for regiospecific midazolam oxidation by human cytochrome P450 3A4.
18	PDB:2j0dB	0.723	0.827	3.939E-22	445	0.212	0.245	2j0dB.pdb.gz	Structural Basis for Ligand Promiscuity in Cytochrome P450 3A4
19	PDB:5veuL	0.722	0.822	1.153E-21	448	0.230	0.263	5veuL.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
20	PDB:7cb9A	0.766	0.839	2.936E-21	466	0.208	0.230	7cb9A.pdb.gz	CYP76AH1 from Salvia miltiorrhiza

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O73684	0.0	730	508	0.681	0.689	O73684_CHICK 25-hydroxyvitamin D3 24-hydroxylase OS=Gallus gallus OX=9031 GN=cP450cc24 PE=2 SV=1
2	Q07973	0.0	1069	514	1.000	1.000	CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP24A1 PE=1 SV=2
3	Q09128	0.0	899	514	0.831	0.831	CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp24a1 PE=1 SV=1
4	Q64441	0.0	899	514	0.829	0.829	CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp24a1 PE=2 SV=1
5	Q90X62	0.0	531	351	0.481	0.704	Q90X62_CHICK Mitochondrial vitamin D 24-hydroxylase variant OS=Gallus gallus OX=9031 GN=CYP24 PE=2 SV=2
6	A0A097HUX0	1.67e-94	298	505	0.325	0.331	A0A097HUX0_DANRE 25-hydroxyvitamin D-1alpha-hydroxylase OS=Danio rerio OX=7955 GN=cyp27b1 PE=2 SV=1
7	Q4G0S4	1.27e-86	278	542	0.305	0.290	C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens OX=9606 GN=CYP27C1 PE=1 SV=3
8	Q02318	7.04e-83	268	531	0.307	0.298	CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27A1 PE=1 SV=1
9	P17178	2.31e-82	267	533	0.300	0.289	CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp27a1 PE=1 SV=1
10	Q9DBG1	2.03e-81	265	533	0.294	0.283	CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27a1 PE=1 SV=1
11	Q7SYJ6	1.89e-76	251	509	0.280	0.283	Q7SYJ6_DANRE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Danio rerio OX=7955 GN=cyp11a1.1 PE=1 SV=1
12	O15528	5.32e-72	239	508	0.307	0.311	CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27B1 PE=1 SV=1
13	O35084	9.86e-70	233	507	0.298	0.302	CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27b1 PE=1 SV=2
14	O35132	2.35e-68	229	501	0.288	0.295	CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp27b1 PE=2 SV=2
15	P00189	7.22e-67	226	520	0.267	0.263	CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus OX=9913 GN=CYP11A1 PE=1 SV=1
16	P05108	8.92e-67	226	521	0.284	0.280	CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11A1 PE=1 SV=2
17	Q9QZ82	9.49e-66	223	526	0.276	0.270	CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus OX=10090 GN=Cyp11a1 PE=1 SV=1
18	P15539	2.89e-64	219	500	0.261	0.268	C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus OX=10090 GN=Cyp11b2 PE=2 SV=3
19	P14137	1.25e-63	218	526	0.263	0.257	CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11a1 PE=1 SV=1
20	Q3TG86	7.56e-63	215	501	0.247	0.253	Q3TG86_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00067 p450	7.3e-103	356.4	Cytochrome P450

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216862

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334592	0.952	Vitamin D 25-hydroxylase
2	9606.ENSP00000228606	0.925	25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
3	9606.ENSP00000447173	0.921	Vitamin D3 receptor
4	9606.ENSP00000314099	0.874	Carbonic anhydrase 5B, mitochondrial
5	9606.ENSP00000318912	0.871	Carbonic anhydrase 13
6	9606.ENSP00000309649	0.870	Carbonic anhydrase 5A, mitochondrial
7	9606.ENSP00000345659	0.870	Carbonic anhydrase 7
8	9606.ENSP00000358107	0.870	Carbonic anhydrase 14
9	9606.ENSP00000430656	0.870	Carbonic anhydrase 1
10	9606.ENSP00000314407	0.868	Carbonic anhydrase-related protein
11	9606.ENSP00000366654	0.858	Carbonic anhydrase 6
12	9606.ENSP00000178638	0.856	Carbonic anhydrase 12
13	9606.ENSP00000421725	0.843	Vitamin D-binding protein
14	9606.ENSP00000285381	0.823	Carbonic anhydrase 3
15	9606.ENSP00000237837	0.810	Fibroblast growth factor 23
16	9606.ENSP00000285379	0.807	Carbonic anhydrase 2
17	9606.ENSP00000300900	0.802	Carbonic anhydrase 4
18	9606.ENSP00000282091	0.789	Parathyroid hormone
19	9606.ENSP00000347717	0.787	7-dehydrocholesterol reductase
20	9606.ENSP00000367608	0.781	Carbonic anhydrase 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016705	1.000	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497	1.000	monooxygenase activity
GO:0005488	0.870	binding
GO:0097159	0.318	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044281	0.995	small molecule metabolic process
GO:0044238	0.995	primary metabolic process
GO:0009987	0.988	cellular process
GO:0006775	0.979	fat-soluble vitamin metabolic process
GO:0008202	0.975	steroid metabolic process
GO:1901615	0.961	organic hydroxy compound metabolic process
GO:0044237	0.928	cellular metabolic process
GO:0050896	0.774	response to stimulus
GO:1901575	0.606	organic substance catabolic process
GO:0042221	0.459	response to chemical
GO:0051716	0.406	cellular response to stimulus
GO:0065007	0.391	biological regulation
GO:0032502	0.348	developmental process
GO:0044282	0.345	small molecule catabolic process
GO:0070887	0.340	cellular response to chemical stimulus
GO:0032501	0.334	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005739	0.889	mitochondrion
GO:0016020	0.853	membrane
GO:0031090	0.416	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.-.-	1.000	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.

[back to server]