StarFunc result for job id Q08050

User Input

>input (763 residues)
MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
GIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPG
LRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNS
LSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYS
YMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETS
ANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELP
LGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIA
PKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVE
SPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRE
RSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKT
PIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLS
TTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTE
GLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08050	0.999	0.999	0.000	763	1.000	1.000	Q08050.pdb.gz	FOXM1_HUMAN Forkhead box protein M1 OS=Homo sapiens OX=9606 GN=FOXM1 PE=1 SV=3
2	AFDB:O08696	0.407	0.408	4.169E-85	760	0.794	0.797	O08696.pdb.gz	FOXM1_MOUSE Forkhead box protein M1 OS=Mus musculus OX=10090 GN=Foxm1 PE=1 SV=2
3	AFDB:B3DGQ4	0.102	0.119	8.808E-12	651	0.168	0.197	B3DGQ4.pdb.gz
4	AFDB:F1NNE8	0.103	0.116	9.150E-11	660	0.159	0.183	F1NNE8.pdb.gz	F1NNE8_CHICK Forkhead box O3 OS=Gallus gallus OX=9031 GN=FOXO3 PE=2 SV=4
5	AFDB:O43058	0.111	0.127	6.416E-9	663	0.165	0.190	O43058.pdb.gz	SEP1_SCHPO Forkhead protein sep1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sep1 PE=1 SV=1
6	PDB:2hdcA	0.094	0.575	1.273E-5	97	0.050	0.392	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
7	AFDB:Q5RIX9	0.075	0.078	1.729E-3	723	0.123	0.130	Q5RIX9.pdb.gz	E2F7_DANRE Transcription factor E2F7 OS=Danio rerio OX=7955 GN=e2f7 PE=1 SV=2
8	AFDB:Q9VYY7	0.047	0.044	1.910E-2	837	0.140	0.128	Q9VYY7.pdb.gz	Q9VYY7_DROME Heterochromatin protein 5, isoform B OS=Drosophila melanogaster OX=7227 GN=HP5 PE=1 SV=1
9	AFDB:Q9UBL0	0.065	0.061	4.812E-2	812	0.138	0.129	Q9UBL0.pdb.gz	ARP21_HUMAN cAMP-regulated phosphoprotein 21 OS=Homo sapiens OX=9606 GN=ARPP21 PE=1 SV=2
10	AFDB:Q9EQY2	0.093	0.114	6.963E-2	579	0.107	0.142	Q9EQY2.pdb.gz
11	PDB:7ctfA	0.081	0.469	7.077E-2	102	0.016	0.118	7ctfA.pdb.gz	Structural insight into the assembly and conformational activation of human origin recognition complex.
12	AFDB:P39969	0.050	0.041	9.474E-2	1040	0.121	0.088	P39969.pdb.gz	BOI2_YEAST Protein BOI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BOI2 PE=1 SV=1
13	PDB:6h1cB	0.084	0.383	1.482E-1	134	0.014	0.082	6h1cB.pdb.gz	Ferric uptake regulator with Mn and Zn form Pseudomonas aeruginosa
14	PDB:3euhB	0.086	0.189	1.576E-1	321	0.013	0.031	3euhB.pdb.gz
15	PDB:4a6dA	0.079	0.163	1.896E-1	345	0.014	0.032	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
16	PDB:7jgrB	0.081	0.195	2.017E-1	290	0.017	0.045	7jgrB.pdb.gz	Structural mechanism for replication origin binding and remodeling by a metazoan origin recognition complex and its co-loader Cdc6.
17	PDB:5zr1B	0.080	0.151	2.145E-1	374	0.017	0.035	5zr1B.pdb.gz	Structure of the origin recognition complex bound to DNA replication origin.
18	PDB:7k5yU	0.076	0.568	2.281E-1	75	0.016	0.160	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
19	PDB:1xsdA	0.080	0.373	2.426E-1	125	0.014	0.088	1xsdA.pdb.gz	Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
20	PDB:2fxaB	0.069	0.251	2.426E-1	180	0.005	0.022	2fxaB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08696	0.0	1135	760	0.793	0.796	FOXM1_MOUSE Forkhead box protein M1 OS=Mus musculus OX=10090 GN=Foxm1 PE=1 SV=2
2	P97691	0.0	1191	759	0.814	0.818	FOXM1_RAT Forkhead box protein M1 OS=Rattus norvegicus OX=10116 GN=Foxm1 PE=2 SV=2
3	Q08050	0.0	1537	763	1.000	1.000	FOXM1_HUMAN Forkhead box protein M1 OS=Homo sapiens OX=9606 GN=FOXM1 PE=1 SV=3
4	Q922T7	6.99e-142	420	295	0.291	0.753	Q922T7_MOUSE Foxm1 protein OS=Mus musculus OX=10090 GN=Foxm1 PE=2 SV=1
5	Q8BUR3	5.24e-19	94.0	623	0.069	0.085	FOXJ3_MOUSE Forkhead box protein J3 OS=Mus musculus OX=10090 GN=Foxj3 PE=1 SV=1
6	Q9UPW0	5.90e-19	94.0	622	0.056	0.069	FOXJ3_HUMAN Forkhead box protein J3 OS=Homo sapiens OX=9606 GN=FOXJ3 PE=1 SV=2
7	Q7SY22	2.19e-18	89.7	363	0.055	0.116	Q7SY22_DANRE Forkhead box L1 OS=Danio rerio OX=7955 GN=zgc:63595 PE=2 SV=1
8	Q12952	4.15e-18	89.0	345	0.054	0.119	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
9	Q64731	1.04e-17	87.4	336	0.052	0.119	FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus OX=10090 GN=Foxl1 PE=2 SV=2
10	Q63248	1.69e-17	80.5	101	0.051	0.386	FOXI2_RAT Forkhead box protein I2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxi2 PE=2 SV=1
11	P25364	2.07e-17	88.6	564	0.051	0.069	HCM1_YEAST Forkhead transcription factor HCM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HCM1 PE=1 SV=3
12	O43638	2.17e-17	86.3	330	0.051	0.118	FOXS1_HUMAN Forkhead box protein S1 OS=Homo sapiens OX=9606 GN=FOXS1 PE=2 SV=2
13	Q61574	2.53e-17	86.3	329	0.051	0.119	FOXS1_MOUSE Forkhead box protein S1 OS=Mus musculus OX=10090 GN=Foxs1 PE=2 SV=2
14	Q804B2	2.61e-17	87.0	377	0.051	0.103	Q804B2_DANRE Forkhead box protein I2 OS=Danio rerio OX=7955 GN=cb724 PE=2 SV=1
15	P32314	3.33e-17	87.0	431	0.075	0.132	FOXN2_HUMAN Forkhead box protein N2 OS=Homo sapiens OX=9606 GN=FOXN2 PE=1 SV=3
16	Q63247	3.90e-17	87.0	421	0.056	0.102	FOXJ1_RAT Forkhead box protein J1 OS=Rattus norvegicus OX=10116 GN=Foxj1 PE=2 SV=1
17	Q92949	3.98e-17	86.7	421	0.056	0.102	FOXJ1_HUMAN Forkhead box protein J1 OS=Homo sapiens OX=9606 GN=FOXJ1 PE=1 SV=3
18	Q61660	4.51e-17	86.7	421	0.056	0.102	FOXJ1_MOUSE Forkhead box protein J1 OS=Mus musculus OX=10090 GN=Foxj1 PE=1 SV=2
19	E0XEN6	4.61e-17	86.3	378	0.051	0.103	E0XEN6_HUMAN Forkhead box I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=4 SV=1
20	Q12951	4.61e-17	86.3	378	0.051	0.103	FOXI1_HUMAN Forkhead box protein I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	9.3e-27	104.3	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342307

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256442	0.997	G2/mitotic-specific cyclin-B1
2	9606.ENSP00000217026	0.996	Myb-related protein B
3	9606.ENSP00000378699	0.996	Cyclin-dependent kinase 1
4	9606.ENSP00000300093	0.995	Serine/threonine-protein kinase PLK1
5	9606.ENSP00000274026	0.994	Cyclin-A2
6	9606.ENSP00000344456	0.994	Catenin beta-1
7	9606.ENSP00000298048	0.993	Maternal embryonic leucine zipper kinase
8	9606.ENSP00000288207	0.992	G2/mitotic-specific cyclin-B2
9	9606.ENSP00000355922	0.992	Centromere protein F
10	9606.ENSP00000266970	0.989	Cyclin-dependent kinase 2
11	9606.ENSP00000262367	0.981	CREB-binding protein
12	9606.ENSP00000361540	0.981	Cell division cycle protein 20 homolog
13	9606.ENSP00000262643	0.980	G1/S-specific cyclin-E1
14	9606.ENSP00000303706	0.976	M-phase inducer phosphatase 1
15	9606.ENSP00000329357	0.974	Transcription factor Sp1
16	9606.ENSP00000257904	0.973	Cyclin-dependent kinase 4
17	9606.ENSP00000357643	0.971	Proliferation marker protein Ki-67
18	9606.ENSP00000264657	0.968	Signal transducer and activator of transcription 3
19	9606.ENSP00000372023	0.967	Serine/threonine-protein kinase Chk2
20	9606.ENSP00000227507	0.965	G1/S-specific cyclin-D1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0019899	0.973	enzyme binding
GO:0000977	0.971	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0019900	0.931	kinase binding
GO:0019901	0.914	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0050896	0.980	response to stimulus
GO:0080090	0.969	regulation of primary metabolic process
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0048522	0.968	positive regulation of cellular process
GO:0060255	0.958	regulation of macromolecule metabolic process
GO:0031323	0.958	regulation of cellular metabolic process
GO:0048583	0.929	regulation of response to stimulus
GO:0007165	0.928	signal transduction
GO:0009893	0.923	positive regulation of metabolic process
GO:0019219	0.915	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.910	positive regulation of nitrogen compound metabolic process
GO:0010604	0.909	positive regulation of macromolecule metabolic process
GO:0031325	0.909	positive regulation of cellular metabolic process
GO:0009889	0.902	regulation of biosynthetic process
GO:0010468	0.887	regulation of gene expression
GO:1903506	0.885	regulation of nucleic acid-templated transcription
GO:0006357	0.881	regulation of transcription by RNA polymerase II
GO:0045935	0.875	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.868	positive regulation of macromolecule biosynthetic process
GO:0031328	0.867	positive regulation of cellular biosynthetic process
GO:0006950	0.862	response to stress
GO:0045893	0.857	positive regulation of DNA-templated transcription
GO:0006974	0.788	cellular response to DNA damage stimulus
GO:0048519	0.768	negative regulation of biological process
GO:0035556	0.768	intracellular signal transduction
GO:0007049	0.746	cell cycle
GO:0048523	0.727	negative regulation of cellular process
GO:0042127	0.658	regulation of cell population proliferation
GO:0022402	0.644	cell cycle process
GO:0000278	0.626	mitotic cell cycle
GO:0009892	0.591	negative regulation of metabolic process
GO:0051726	0.561	regulation of cell cycle
GO:0010605	0.483	negative regulation of macromolecule metabolic process
GO:0051172	0.482	negative regulation of nitrogen compound metabolic process
GO:0072331	0.467	signal transduction by p53 class mediator
GO:1903047	0.462	mitotic cell cycle process
GO:0045944	0.460	positive regulation of transcription by RNA polymerase II
GO:0031324	0.452	negative regulation of cellular metabolic process
GO:0051128	0.442	regulation of cellular component organization
GO:0045934	0.413	negative regulation of nucleobase-containing compound metabolic process
GO:0009890	0.385	negative regulation of biosynthetic process
GO:0032502	0.374	developmental process
GO:0051052	0.373	regulation of DNA metabolic process
GO:0080135	0.356	regulation of cellular response to stress
GO:0048856	0.342	anatomical structure development
GO:0009966	0.339	regulation of signal transduction
GO:0031327	0.337	negative regulation of cellular biosynthetic process
GO:0042770	0.325	signal transduction in response to DNA damage
GO:0032501	0.313	multicellular organismal process
GO:0008152	0.308	metabolic process
GO:0006282	0.308	regulation of DNA repair
GO:0048584	0.306	positive regulation of response to stimulus
GO:2000779	0.303	regulation of double-strand break repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.922	intracellular non-membrane-bounded organelle
GO:0005737	0.569	cytoplasm
GO:0005829	0.402	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]