StarFunc result for job id Q08116

User Input

>input (209 residues)
MRAAAISTPKLDKMPGMFFSANPKELKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPH
LESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACED
YKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYT
LMEKDSYPRFLKSDIYLNLLNDLQANSLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08116	1.000	1.000	1.192E-28	209	1.000	1.000	Q08116.pdb.gz	RGS1_HUMAN Regulator of G-protein signaling 1 OS=Homo sapiens OX=9606 GN=RGS1 PE=1 SV=3
2	AFDB:Q9JL25	0.708	0.708	4.592E-26	209	0.866	0.866	Q9JL25.pdb.gz	RGS1_MOUSE Regulator of G-protein signaling 1 OS=Mus musculus OX=10090 GN=Rgs1 PE=2 SV=2
3	AFDB:Q9NS28	0.610	0.543	1.049E-13	235	0.344	0.306	Q9NS28.pdb.gz	RGS18_HUMAN Regulator of G-protein signaling 18 OS=Homo sapiens OX=9606 GN=RGS18 PE=1 SV=1
4	AFDB:Q99PG4	0.610	0.544	1.103E-13	235	0.373	0.332	Q99PG4.pdb.gz	RGS18_MOUSE Regulator of G-protein signaling 18 OS=Mus musculus OX=10090 GN=Rgs18 PE=1 SV=1
5	AFDB:Q08BE2	0.601	0.604	1.652E-13	208	0.354	0.356	Q08BE2.pdb.gz	Q08BE2_DANRE Regulator of G-protein signaling 18 OS=Danio rerio OX=7955 GN=zgc:153888 PE=2 SV=1
6	AFDB:A8WGN3	0.606	0.589	2.021E-13	215	0.335	0.326	A8WGN3.pdb.gz
7	AFDB:P49804	0.631	0.731	2.021E-13	180	0.344	0.400	P49804.pdb.gz	RGS8_RAT Regulator of G-protein signaling 8 OS=Rattus norvegicus OX=10116 GN=Rgs8 PE=1 SV=2
8	AFDB:O08899	0.612	0.624	2.877E-13	205	0.364	0.371	O08899.pdb.gz	RGS4_MOUSE Regulator of G-protein signaling 4 OS=Mus musculus OX=10090 GN=Rgs4 PE=2 SV=1
9	AFDB:V9GXQ3	0.615	0.840	3.703E-13	152	0.359	0.493	V9GXQ3.pdb.gz	V9GXQ3_MOUSE Regulator of G protein Signaling 21 variant 1 OS=Mus musculus OX=10090 GN=Rgs21 PE=2 SV=1
10	AFDB:P49797	0.626	0.143	5.271E-13	967	0.349	0.075	P49797.pdb.gz	RGS3_RAT Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2
11	PDB:1agrE	0.594	0.963	6.257E-11	128	0.325	0.531	1agrE.pdb.gz	Structure of RGS4 bound to AlF4--activated G(i alpha1): stabilization of the transition state for GTP hydrolysis.
12	PDB:7shfC	0.592	0.316	2.034E-9	400	0.263	0.138	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
13	PDB:6pjxA	0.506	0.213	4.437E-5	543	0.129	0.050	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
14	PDB:3c4wB	0.472	0.208	6.316E-5	519	0.144	0.058	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
15	PDB:4gouA	0.460	0.199	2.594E-4	507	0.124	0.051	4gouA.pdb.gz
16	PDB:4mk0A	0.485	0.178	6.766E-4	631	0.144	0.048	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	PDB:3nynA	0.472	0.192	1.240E-3	554	0.134	0.051	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
18	PDB:3uzsA	0.483	0.184	1.856E-3	609	0.144	0.049	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
19	PDB:4yhjA	0.490	0.221	1.856E-3	501	0.105	0.044	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
20	PDB:3c51B	0.444	0.217	3.074E-3	461	0.124	0.056	3c51B.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08116	8.70e-157	433	209	1.000	1.000	RGS1_HUMAN Regulator of G-protein signaling 1 OS=Homo sapiens OX=9606 GN=RGS1 PE=1 SV=3
2	Q9JL25	7.04e-135	378	209	0.866	0.866	RGS1_MOUSE Regulator of G-protein signaling 1 OS=Mus musculus OX=10090 GN=Rgs1 PE=2 SV=2
3	A0A5S9EHU3	2.46e-50	162	147	0.364	0.517	A0A5S9EHU3_MOUSE Regulator of G protein Signaling 21 variant 2 OS=Mus musculus OX=10090 GN=Rgs21 PE=2 SV=1
4	V9GXQ3	4.55e-50	161	152	0.364	0.500	V9GXQ3_MOUSE Regulator of G protein Signaling 21 variant 1 OS=Mus musculus OX=10090 GN=Rgs21 PE=2 SV=1
5	Q2M5E4	2.05e-49	159	152	0.373	0.513	RGS21_HUMAN Regulator of G-protein signaling 21 OS=Homo sapiens OX=9606 GN=RGS21 PE=2 SV=1
6	A0A5S9EHU9	7.33e-47	152	131	0.349	0.557	A0A5S9EHU9_MOUSE Regulator of G protein Signaling 21 variant 3 OS=Mus musculus OX=10090 GN=Rgs21 PE=2 SV=1
7	Q8BXT1	1.34e-44	148	180	0.330	0.383	RGS8_MOUSE Regulator of G-protein signaling 8 OS=Mus musculus OX=10090 GN=Rgs8 PE=1 SV=1
8	P57771	3.08e-44	147	180	0.330	0.383	RGS8_HUMAN Regulator of G-protein signaling 8 OS=Homo sapiens OX=9606 GN=RGS8 PE=1 SV=1
9	P49804	3.59e-44	147	180	0.330	0.383	RGS8_RAT Regulator of G-protein signaling 8 OS=Rattus norvegicus OX=10116 GN=Rgs8 PE=1 SV=2
10	Q9DC04	2.07e-43	157	966	0.402	0.087	RGS3_MOUSE Regulator of G-protein signaling 3 OS=Mus musculus OX=10090 GN=Rgs3 PE=1 SV=2
11	O14921	4.65e-43	144	159	0.311	0.409	RGS13_HUMAN Regulator of G-protein signaling 13 OS=Homo sapiens OX=9606 GN=RGS13 PE=1 SV=1
12	A0A087WUY2	1.62e-42	143	192	0.316	0.344	A0A087WUY2_HUMAN Regulator of G protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=1
13	P49798	3.20e-42	143	205	0.335	0.341	RGS4_HUMAN Regulator of G-protein signaling 4 OS=Homo sapiens OX=9606 GN=RGS4 PE=1 SV=1
14	P49800	3.33e-42	142	181	0.354	0.409	RGS5_RAT Regulator of G-protein signaling 5 OS=Rattus norvegicus OX=10116 GN=Rgs5 PE=2 SV=2
15	O08850	4.01e-42	142	181	0.354	0.409	RGS5_MOUSE Regulator of G-protein signaling 5 OS=Mus musculus OX=10090 GN=Rgs5 PE=2 SV=2
16	P49797	7.70e-42	152	967	0.411	0.089	RGS3_RAT Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2
17	P49799	1.54e-41	141	205	0.335	0.341	RGS4_RAT Regulator of G-protein signaling 4 OS=Rattus norvegicus OX=10116 GN=Rgs4 PE=1 SV=1
18	O08899	2.17e-41	141	205	0.330	0.337	RGS4_MOUSE Regulator of G-protein signaling 4 OS=Mus musculus OX=10090 GN=Rgs4 PE=2 SV=1
19	Q9NS28	2.45e-41	142	235	0.330	0.294	RGS18_HUMAN Regulator of G-protein signaling 18 OS=Homo sapiens OX=9606 GN=RGS18 PE=1 SV=1
20	Q08BE2	3.72e-41	140	208	0.325	0.327	Q08BE2_DANRE Regulator of G-protein signaling 18 OS=Danio rerio OX=7955 GN=zgc:153888 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00615 RGS	1.7e-35	133.3	Regulator of G protein signaling domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356429

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343027	0.988	Guanine nucleotide-binding protein G(i) subunit alpha-1
2	9606.ENSP00000478892	0.962	Guanine nucleotide-binding protein G(z) subunit alpha
3	9606.ENSP00000262494	0.961	Guanine nucleotide-binding protein G(o) subunit alpha
4	9606.ENSP00000312999	0.951	Guanine nucleotide-binding protein G(i) subunit alpha-2
5	9606.ENSP00000358867	0.951	Guanine nucleotide-binding protein G(k) subunit alpha
6	9606.ENSP00000378786	0.941	HLA class II histocompatibility antigen, DR alpha chain
7	9606.ENSP00000353099	0.939	HLA class II histocompatibility antigen, DRB1-15 beta chain
8	9606.ENSP00000011653	0.933	T-cell surface glycoprotein CD4
9	9606.ENSP00000235382	0.922	Regulator of G-protein signaling 2
10	9606.ENSP00000297313	0.921	Regulator of G-protein signaling 20
11	9606.ENSP00000337825	0.921	Tyrosine-protein kinase Lck
12	9606.ENSP00000356430	0.921	Regulator of G-protein signaling 18
13	9606.ENSP00000386229	0.916	Regulator of G-protein signaling 14
14	9606.ENSP00000356529	0.914	Regulator of G-protein signaling 16
15	9606.ENSP00000358099	0.914	Regulator of G-protein signaling 10
16	9606.ENSP00000451030	0.913	Regulator of G-protein signaling 6
17	9606.ENSP00000300692	0.912	T-cell surface glycoprotein CD3 delta chain
18	9606.ENSP00000339381	0.912	Regulator of G-protein signaling 12
19	9606.ENSP00000355523	0.912	Regulator of G-protein signaling 7
20	9606.ENSP00000378483	0.912	Regulator of G-protein signaling 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0003824	0.996	catalytic activity
GO:0003924	0.993	GTPase activity
GO:0005516	0.851	calmodulin binding
GO:0001965	0.585	G-protein alpha-subunit binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.998	signal transduction
GO:0007186	0.984	G protein-coupled receptor signaling pathway
GO:0065009	0.515	regulation of molecular function
GO:0050790	0.494	regulation of catalytic activity
GO:0048583	0.347	regulation of response to stimulus
GO:0044093	0.336	positive regulation of molecular function
GO:0002376	0.317	immune system process
GO:0051336	0.314	regulation of hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.989	intracellular anatomical structure
GO:0005829	0.921	cytosol
GO:0043226	0.803	organelle
GO:0043231	0.779	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.993	GTP + H2O = GDP + H(+) + phosphate

[back to server]