StarFunc result for job id Q08170

User Input

>input (494 residues)
MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDL
CGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDL
KDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVEDKPGSR
RRRSYSRSRSHSRSRSRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSRSRSKSRSRSQSRS
RSKKEKSRSPSKEKSRSRSHSAGKSRSKSKDQAEEKIQNNDNVGKPKSRSPSRHKSKSKS
RSRSQERRVEEEKRGSVSRGRSQEKSLRQSRSRSRSKGGSRSRSRSRSKSKDKRKGRKRS
REESRSRSRSRSKSERSRKRGSKRDSKAGSSKKKKKEDTDRSQSRSPSRSVSKEREHAKS
ESSQREGRGESENAGTNQETRSRSRSNSKSKPNLPSESRSRSKSASKTRSRSKSRSRSAS
RSPSRSRSRSHSRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08170	1.000	1.000	3.037E-61	494	1.000	1.000	Q08170.pdb.gz	SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2
2	AFDB:Q8VE97	0.366	0.370	5.409E-49	489	0.858	0.867	Q8VE97.pdb.gz	SRSF4_MOUSE Serine/arginine-rich splicing factor 4 OS=Mus musculus OX=10090 GN=Srsf4 PE=2 SV=1
3	AFDB:Q802Y1	0.334	0.434	1.340E-33	366	0.480	0.648	Q802Y1.pdb.gz	Q802Y1_DANRE Serine and arginine-rich-splicing factor 4 OS=Danio rerio OX=7955 GN=zgc:55809 PE=1 SV=1
4	AFDB:Q8IJI0	0.155	0.144	1.331E-19	538	0.314	0.288	Q8IJI0.pdb.gz	Q8IJI0_PLAF7 Serine/arginine-rich splicing factor 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1022400 PE=4 SV=1
5	AFDB:F4JFN7	0.148	0.148	5.753E-13	495	0.178	0.178	F4JFN7.pdb.gz	F4JFN7_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g07810 PE=1 SV=1
6	AFDB:A0A0S2Z4Z0	0.203	0.158	1.136E-12	669	0.154	0.114	A0A0S2Z4Z0.pdb.gz	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
7	AFDB:Q8W4I9	0.147	0.081	1.208E-12	915	0.176	0.095	Q8W4I9.pdb.gz	AML1_ARATH Protein MEI2-like 1 OS=Arabidopsis thaliana OX=3702 GN=ML1 PE=1 SV=1
8	AFDB:Q57WD0	0.144	0.120	4.649E-11	593	0.168	0.140	Q57WD0.pdb.gz	Q57WD0_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.400 PE=4 SV=1
9	PDB:7oqcF	0.139	0.254	1.966E-10	267	0.069	0.127	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
10	PDB:6y53o	0.175	0.409	4.905E-9	160	0.075	0.231	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
11	PDB:5vsuA	0.139	0.174	1.690E-8	387	0.073	0.093	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
12	PDB:6r5kH	0.138	0.172	5.475E-8	394	0.073	0.091	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
13	PDB:6y5qq	0.135	0.363	6.592E-8	178	0.059	0.163	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	AFDB:Q14966	0.152	0.057	7.317E-8	1978	0.134	0.033	Q14966.pdb.gz	ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2
15	PDB:7evoD	0.135	0.328	1.385E-7	200	0.065	0.160	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
16	PDB:6ff7X	0.137	0.378	2.571E-7	171	0.061	0.175	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:5lsbA	0.151	0.390	7.358E-7	176	0.055	0.153	5lsbA.pdb.gz
18	PDB:5xjcw	0.141	0.735	3.910E-6	91	0.049	0.264	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
19	AFDB:Q1PEP5	0.192	0.157	4.616E-6	636	0.134	0.104	Q1PEP5.pdb.gz	NUCL2_ARATH Nucleolin 2 OS=Arabidopsis thaliana OX=3702 GN=NUCL2 PE=1 SV=1
20	PDB:3lqvB	0.136	0.570	6.028E-6	115	0.036	0.157	3lqvB.pdb.gz	Branch Recognition by SF3b14

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08170	0.0	916	494	1.000	1.000	SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2
2	Q8VE97	7.15e-172	494	489	0.783	0.791	SRSF4_MOUSE Serine/arginine-rich splicing factor 4 OS=Mus musculus OX=10090 GN=Srsf4 PE=2 SV=1
3	G3V798	1.62e-153	448	488	0.615	0.623	G3V798_RAT Serine and arginine rich splicing factor 4 OS=Rattus norvegicus OX=10116 GN=Srsf4 PE=4 SV=1
4	A0A8I5ZP75	8.79e-123	369	466	0.543	0.575	A0A8I5ZP75_RAT Serine and arginine rich splicing factor 4 OS=Rattus norvegicus OX=10116 GN=Srsf4 PE=1 SV=1
5	Q13247	1.62e-101	310	344	0.298	0.427	SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2
6	G3V6S8	1.77e-100	307	339	0.294	0.428	SRSF6_RAT Serine/arginine-rich splicing factor 6 OS=Rattus norvegicus OX=10116 GN=Srsf6 PE=1 SV=1
7	Q3TWW8	1.77e-100	307	339	0.294	0.428	SRSF6_MOUSE Serine/arginine-rich splicing factor 6 OS=Mus musculus OX=10090 GN=Srsf6 PE=1 SV=1
8	Q802Y1	2.06e-98	303	366	0.302	0.407	Q802Y1_DANRE Serine and arginine-rich-splicing factor 4 OS=Danio rerio OX=7955 GN=zgc:55809 PE=1 SV=1
9	P26686	1.03e-76	247	376	0.255	0.335	SRR55_DROME Serine-arginine protein 55 OS=Drosophila melanogaster OX=7227 GN=B52 PE=1 SV=4
10	O35326	1.43e-70	228	269	0.231	0.424	SRSF5_MOUSE Serine/arginine-rich splicing factor 5 OS=Mus musculus OX=10090 GN=Srsf5 PE=1 SV=2
11	Q09167	1.43e-70	228	269	0.231	0.424	SRSF5_RAT Serine/arginine-rich splicing factor 5 OS=Rattus norvegicus OX=10116 GN=Srsf5 PE=1 SV=1
12	Q13243	1.57e-70	228	272	0.231	0.419	SRSF5_HUMAN Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 PE=1 SV=1
13	Q23120	9.33e-58	194	281	0.186	0.327	RSP2_CAEEL Probable splicing factor, arginine/serine-rich 2 OS=Caenorhabditis elegans OX=6239 GN=rsp-2 PE=3 SV=1
14	Q23121	4.01e-51	178	312	0.198	0.314	RSP1_CAEEL Probable splicing factor, arginine/serine-rich 1 OS=Caenorhabditis elegans OX=6239 GN=rsp-1 PE=3 SV=1
15	P78814	1.07e-41	154	365	0.166	0.225	SRP2_SCHPO Pre-mRNA-splicing factor srp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srp2 PE=1 SV=2
16	B4DJK0	1.92e-37	135	124	0.152	0.605	B4DJK0_HUMAN Serine and arginine rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 PE=1 SV=1
17	B4DUA4	3.09e-37	135	138	0.152	0.543	B4DUA4_HUMAN Serine and arginine rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 PE=1 SV=1
18	B1H240	7.47e-35	135	349	0.334	0.473	B1H240_RAT Sfrs4 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Srsf4 PE=2 SV=1
19	Q8IJI0	4.29e-33	134	538	0.263	0.242	Q8IJI0_PLAF7 Serine/arginine-rich splicing factor 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1022400 PE=4 SV=1
20	Q5PPI1	7.78e-31	120	221	0.150	0.335	SRSF9_RAT Serine/arginine-rich splicing factor 9 OS=Rattus norvegicus OX=10116 GN=Srsf9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03880 DbpA	1e+02	14.3	DbpA RNA binding domain
2	PF14605 Nup35_RRM_2	1.4e+02	13.8	Nup53/35/40-type RNA recognition motif
3	PF00076 RRM_1	4.1e-28	108.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF08777 RRM_3	0.019	26.4	RNA binding motif
5	PF13893 RRM_5	92	14.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362900

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000457723	0.974	RNA-binding protein with serine-rich domain 1
2	9606.ENSP00000362931	0.972	SRSF protein kinase 1
3	9606.ENSP00000376276	0.957	Serine/arginine-rich splicing factor 2
4	9606.ENSP00000307863	0.956	Splicing factor U2AF 65 kDa subunit
5	9606.ENSP00000326261	0.944	Serine/arginine repetitive matrix protein 1
6	9606.ENSP00000359988	0.944	Serine/arginine-rich splicing factor 11
7	9606.ENSP00000258962	0.943	Serine/arginine-rich splicing factor 1
8	9606.ENSP00000244020	0.936	Serine/arginine-rich splicing factor 6
9	9606.ENSP00000421592	0.920	THO complex subunit 4
10	9606.ENSP00000301740	0.917	Serine/arginine repetitive matrix protein 2
11	9606.ENSP00000357928	0.898	Pre-mRNA-processing factor 17
12	9606.ENSP00000265388	0.894	Transportin-3
13	9606.ENSP00000269349	0.893	Eukaryotic initiation factor 4A-III
14	9606.ENSP00000362820	0.888	Serine/arginine-rich splicing factor 3
15	9606.ENSP00000297151	0.880	Pre-mRNA-splicing factor SLU7
16	9606.ENSP00000216727	0.875	Polyadenylate-binding protein 2
17	9606.ENSP00000325905	0.873	Serine/arginine-rich splicing factor 7
18	9606.ENSP00000216277	0.871	Poly(A) polymerase alpha
19	9606.ENSP00000364289	0.840	Nuclear cap-binding protein subunit 1
20	9606.ENSP00000229390	0.839	Serine/arginine-rich splicing factor 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.569	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0071704	0.987	organic substance metabolic process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0043170	0.980	macromolecule metabolic process
GO:0044238	0.976	primary metabolic process
GO:0044237	0.976	cellular metabolic process
GO:0006807	0.969	nitrogen compound metabolic process
GO:0060255	0.967	regulation of macromolecule metabolic process
GO:0010467	0.949	gene expression
GO:0016070	0.949	RNA metabolic process
GO:0080090	0.937	regulation of primary metabolic process
GO:0051171	0.937	regulation of nitrogen compound metabolic process
GO:0031323	0.937	regulation of cellular metabolic process
GO:0008380	0.931	RNA splicing
GO:0016071	0.927	mRNA metabolic process
GO:0019219	0.911	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.900	regulation of gene expression
GO:0051252	0.897	regulation of RNA metabolic process
GO:0006397	0.889	mRNA processing
GO:0048519	0.792	negative regulation of biological process
GO:0000375	0.783	RNA splicing, via transesterification reactions
GO:0050896	0.763	response to stimulus
GO:0009719	0.749	response to endogenous stimulus
GO:0043484	0.675	regulation of RNA splicing
GO:0042221	0.674	response to chemical
GO:1903311	0.667	regulation of mRNA metabolic process
GO:1901698	0.654	response to nitrogen compound
GO:0048523	0.539	negative regulation of cellular process
GO:0010605	0.531	negative regulation of macromolecule metabolic process
GO:0051172	0.416	negative regulation of nitrogen compound metabolic process
GO:0010629	0.408	negative regulation of gene expression
GO:0031324	0.365	negative regulation of cellular metabolic process
GO:0000398	0.362	mRNA splicing, via spliceosome
GO:0050684	0.359	regulation of mRNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0016604	0.951	nuclear body
GO:0016607	0.913	nuclear speck
GO:0032991	0.408	protein-containing complex
GO:0005737	0.366	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]