StarFunc result for job id Q08174

User Input

>input (1060 residues)
MDSGAGGRRCPEAALLILGPPRMEHLRHSPGPGGQRLLLPSMLLALLLLLAPSPGHATRV
VYKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGL
RECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPEN
TNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDR
ERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVI
QVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAK
DRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVS
DRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVD
SGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAE
LVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLV
NVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVI
QNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSN
TSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEI
ERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANRTLLETLLGHSLDTPLDIDIAG
DPEYERSKQRGNILFGVVAGVVAVALLIALAVLVRYCRQREAKSGYQAGKKETKDLYAPK
PSGKASKGNKSKGKKSKSPKPVKPVEDEDEAGLQKSLKFNLMSDAPGDSPRIHLPLNYPP
GSPDLGRHYRSNSPLPSIQLQPQSPSASKKHQVVQDLPPANTFVGTGDTTSTGSEQYSDY
SYRTNPPKYPSKQVGQPFQLSTPQPLPHPYHGAIWTEVWE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F7BJK1	0.604	0.595	0.000	1077	0.803	0.790	F7BJK1.pdb.gz	F7BJK1_MOUSE Protocadherin 1 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh1 PE=1 SV=1
2	AFDB:O57537	0.681	0.697	0.000	1035	0.490	0.501	O57537.pdb.gz	O57537_XENLA NF-protocadherin OS=Xenopus laevis OX=8355 GN=pcdh7.L PE=2 SV=1
3	AFDB:Q08174	1.000	1.000	0.000	1060	1.000	1.000	Q08174.pdb.gz	PCDH1_HUMAN Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2
4	AFDB:A0A0A6YWY8	0.652	0.579	2.923E-100	1203	0.391	0.344	A0A0A6YWY8.pdb.gz	A0A0A6YWY8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
5	AFDB:B2RY69	0.653	0.565	4.633E-99	1237	0.390	0.334	B2RY69.pdb.gz	B2RY69_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
6	AFDB:B2RXR7	0.649	0.596	5.358E-99	1161	0.392	0.357	B2RXR7.pdb.gz	B2RXR7_MOUSE Pcdh9 protein OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
7	AFDB:Q9BZA7	0.601	0.477	1.346E-98	1347	0.380	0.299	Q9BZA7.pdb.gz	PC11X_HUMAN Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1
8	AFDB:F6ZNL5	0.477	0.385	1.891E-92	1338	0.387	0.306	F6ZNL5.pdb.gz	F6ZNL5_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
9	AFDB:F1QRP2	0.437	0.409	7.922E-73	1135	0.253	0.236	F1QRP2.pdb.gz	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
10	AFDB:Q6IS19	0.406	0.419	8.318E-71	1026	0.255	0.263	Q6IS19.pdb.gz
11	PDB:7sqcO0	0.146	0.138	7.450E-16	1140	0.080	0.075	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:6velC	0.170	0.796	3.601E-14	209	0.058	0.292	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
13	PDB:4aq1A	0.106	0.144	2.062E-13	721	0.076	0.112	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
14	PDB:1e07A	0.145	0.200	2.896E-13	642	0.078	0.129	1e07A.pdb.gz
15	PDB:5oj2B	0.129	0.178	3.602E-12	692	0.096	0.147	5oj2B.pdb.gz
16	PDB:7q1yA	0.101	0.084	6.766E-10	1374	0.093	0.072	7q1yA.pdb.gz
17	PDB:7q5zA	0.082	0.071	9.972E-10	1344	0.092	0.072	7q5zA.pdb.gz
18	PDB:7nycA	0.090	0.069	4.938E-9	1542	0.088	0.060	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:5a42A	0.083	0.061	3.433E-8	1597	0.085	0.056	5a42A.pdb.gz
20	PDB:7vonA	0.086	0.070	2.506E-7	1399	0.075	0.057	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087X2C4	939	1269	0.487	0.407	A0A087X2C4_HUMAN Protocadherin 7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2
2	A0A0A6YWK0	640	1026	0.378	0.391	A0A0A6YWK0_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
3	A0A0A6YWM0	623	873	0.353	0.428	A0A0A6YWM0_MOUSE Protocadherin 9 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
4	A0A0A6YWY8	669	1203	0.395	0.348	A0A0A6YWY8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
5	A0A0A6YY09	669	1195	0.395	0.351	A0A0A6YY09_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
6	A0A0A6YY37	627	1038	0.360	0.368	A0A0A6YY37_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
7	A0A0A6YY48	729	802	0.368	0.486	A0A0A6YY48_MOUSE Protocadherin 7 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
8	A0A0A6YY83	847	1255	0.461	0.390	A0A0A6YY83_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
9	A0A8I5ZK96	671	1237	0.395	0.339	A0A8I5ZK96_RAT Protocadherin 9 OS=Rattus norvegicus OX=10116 GN=Pcdh9 PE=4 SV=1
10	A0JNT1	640	1128	0.378	0.355	A0JNT1_MOUSE Pcdh11x protein OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
11	A2RS43	845	1069	0.456	0.452	A2RS43_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
12	B1AZR7	640	1320	0.378	0.304	B1AZR7_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
13	B2RXR7	669	1161	0.395	0.361	B2RXR7_MOUSE Pcdh9 protein OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
14	B2RY66	669	1203	0.395	0.348	B2RY66_MOUSE Pcdh9 protein OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
15	B2RY69	669	1237	0.395	0.339	B2RY69_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
16	E9Q2S0	847	1247	0.461	0.392	E9Q2S0_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=2
17	E9Q622	639	1334	0.378	0.301	E9Q622_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
18	F1LS01	670	1203	0.395	0.348	F1LS01_RAT Protocadherin 9 OS=Rattus norvegicus OX=10116 GN=Pcdh9 PE=4 SV=4
19	F6ZNL5	640	1338	0.378	0.300	F6ZNL5_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
20	F7BJK1	1730	1077	0.799	0.786	F7BJK1_MOUSE Protocadherin 1 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	1.9e-110	372.9	Cadherin domain
2	PF08266 Cadherin_2	1.1e-10	52.5	Cadherin-like
3	PF16184 Cadherin_3	6.3e-06	37.5	Cadherin-like
4	PF16319 DUF4958	3.9	17.0	Domain of unknown function (DUF4958)
5	PF16403 DUF5011	4.2e+02	12.4	Domain of unknown function (DUF5011)
6	PF08374 Protocadherin	7.2e-76	266.5	Protocadherin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287008

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000412763	0.625	MAM and LDL-receptor class A domain-containing protein 1
2	9606.ENSP00000307519	0.610	Transmembrane protease serine 11E
3	9606.ENSP00000479816	0.601	DENN domain-containing protein 1B
4	9606.ENSP00000353741	0.570	Eukaryotic peptide chain release factor subunit 1
5	9606.ENSP00000414350	0.553	Mucin-20
6	9606.ENSP00000274457	0.536	Protein fem-1 homolog C
7	9606.ENSP00000260643	0.517	Prolactin regulatory element-binding protein
8	9606.ENSP00000472286	0.512	SURP and G-patch domain-containing protein 2
9	9606.ENSP00000332973	0.509	Mothers against decapentaplegic homolog 3
10	9606.ENSP00000369198	0.509	Adhesion G-protein coupled receptor G2
11	9606.ENSP00000347454	0.505	Anoctamin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0007156	0.633	homophilic cell adhesion via plasma membrane adhesion molecules
GO:0016339	0.491	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0065007	0.478	biological regulation
GO:0050789	0.456	regulation of biological process
GO:0050794	0.387	regulation of cellular process
GO:0032501	0.368	multicellular organismal process
GO:0032502	0.320	developmental process
GO:0048856	0.308	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005911	0.959	cell-cell junction
GO:0005622	0.806	intracellular anatomical structure
GO:0043227	0.746	membrane-bounded organelle
GO:0005737	0.629	cytoplasm
GO:0043229	0.590	intracellular organelle
GO:0043231	0.573	intracellular membrane-bounded organelle
GO:0070013	0.498	intracellular organelle lumen
GO:0031981	0.494	nuclear lumen
GO:0005654	0.315	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]