StarFunc result for job id Q08209

User Input

>input (521 residues)
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z4C6	0.883	0.883	3.507E-88	521	1.000	1.000	A0A0S2Z4C6.pdb.gz	A0A0S2Z4C6_HUMAN Serine/threonine-protein phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=PPP3CA PE=2 SV=1
2	AFDB:P48454	0.847	0.861	7.721E-82	512	0.789	0.803	P48454.pdb.gz	PP2BC_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP3CC PE=1 SV=3
3	AFDB:P20651	0.809	0.803	6.011E-80	525	0.816	0.810	P20651.pdb.gz	PP2BB_RAT Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Rattus norvegicus OX=10116 GN=Ppp3cb PE=1 SV=1
4	AFDB:E2CWF0	0.888	0.898	1.380E-78	515	0.756	0.765	E2CWF0.pdb.gz	E2CWF0_RAT Serine/threonine-protein phosphatase OS=Rattus norvegicus OX=10116 GN=Ppp3cc PE=2 SV=1
5	AFDB:Q9VXF1	0.844	0.757	5.572E-76	584	0.762	0.680	Q9VXF1.pdb.gz	PP2B3_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 3 OS=Drosophila melanogaster OX=7227 GN=CanA-14F PE=1 SV=4
6	AFDB:Q27889	0.838	0.770	1.993E-75	570	0.766	0.700	Q27889.pdb.gz	PP2B2_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 2 OS=Drosophila melanogaster OX=7227 GN=Pp2B-14D PE=1 SV=2
7	AFDB:Q0G819	0.850	0.818	1.582E-74	542	0.704	0.677	Q0G819.pdb.gz	PP2B_CAEEL Serine/threonine-protein phosphatase 2B catalytic subunit OS=Caenorhabditis elegans OX=6239 GN=tax-6 PE=1 SV=2
8	AFDB:E2CWF1	0.757	0.815	1.986E-72	483	0.718	0.774	E2CWF1.pdb.gz	E2CWF1_RAT Serine/threonine-protein phosphatase OS=Rattus norvegicus OX=10116 GN=Ppp3cc PE=2 SV=1
9	AFDB:P48456	0.789	0.666	1.030E-71	622	0.724	0.606	P48456.pdb.gz	PP2B1_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 1 OS=Drosophila melanogaster OX=7227 GN=CanA1 PE=2 SV=2
10	AFDB:O42773	0.778	0.640	1.483E-65	639	0.591	0.482	O42773.pdb.gz	PP2B1_CRYNH Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNA1 PE=1 SV=1
11	PDB:4or9A	0.706	0.917	3.410E-63	399	0.670	0.875	4or9A.pdb.gz	Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
12	PDB:4il1A	0.691	0.681	7.563E-63	529	0.716	0.705	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
13	PDB:2nppC	0.534	0.889	5.982E-31	308	0.244	0.412	2nppC.pdb.gz	Structure of the protein phosphatase 2A holoenzyme
14	PDB:7obeA	0.553	0.599	3.045E-29	480	0.244	0.265	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
15	PDB:1wao1	0.556	0.613	2.548E-28	471	0.228	0.253	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
16	PDB:1s70A	0.533	0.887	1.014E-27	309	0.211	0.356	1s70A.pdb.gz	Structural basis of protein phosphatase 1 regulation
17	PDB:6zejI	0.528	0.775	1.917E-27	351	0.219	0.325	6zejI.pdb.gz	Molecular basis for substrate specificity of the Phactr1/PP1 phosphatase holoenzyme.
18	PDB:1g5bB	0.278	0.603	3.129E-8	221	0.084	0.199	1g5bB.pdb.gz	Structure of the bacteriophage lambda Ser/Thr protein phosphatase with sulfate ion bound in two coordination modes.
19	PDB:3ib7A	0.223	0.351	7.403E-3	295	0.063	0.112	3ib7A.pdb.gz	A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability
20	PDB:4dsyB	0.236	0.277	8.681E-3	426	0.081	0.099	4dsyB.pdb.gz	Identification of purple acid phosphatase inhibitors by fragment-based screening: promising new leads for osteoporosis therapeutics.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K820	829	496	0.741	0.778	A0A0G2K820_RAT Serine/threonine-protein phosphatase OS=Rattus norvegicus OX=10116 GN=Ppp3cc PE=3 SV=1
2	A0A0S2Z4B5	1063	511	0.981	1.000	A0A0S2Z4B5_HUMAN Serine/threonine-protein phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=PPP3CA PE=2 SV=1
3	A0A0S2Z4C6	1091	521	1.000	1.000	A0A0S2Z4C6_HUMAN Serine/threonine-protein phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=PPP3CA PE=2 SV=1
4	A0A1D8PCA8	581	609	0.537	0.460	A0A1D8PCA8_CANAL Serine/threonine-protein phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CMP1 PE=3 SV=1
5	A0A8I6GLU2	828	505	0.735	0.758	A0A8I6GLU2_RAT Serine/threonine-protein phosphatase OS=Rattus norvegicus OX=10116 GN=Ppp3cc PE=3 SV=1
6	A0A8J8XJJ2	828	502	0.739	0.767	A0A8J8XJJ2_RAT Serine/threonine-protein phosphatase OS=Rattus norvegicus OX=10116 GN=Ppp3cc PE=3 SV=1
7	B9W6M3	546	607	0.509	0.437	B9W6M3_CANDC Serine/threonine-protein phosphatase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) OX=573826 GN=CNA1 PE=3 SV=1
8	E2CWF0	843	515	0.752	0.761	E2CWF0_RAT Serine/threonine-protein phosphatase OS=Rattus norvegicus OX=10116 GN=Ppp3cc PE=2 SV=1
9	E2CWF1	803	483	0.720	0.776	E2CWF1_RAT Serine/threonine-protein phosphatase OS=Rattus norvegicus OX=10116 GN=Ppp3cc PE=2 SV=1
10	O42773	650	639	0.591	0.482	PP2B1_CRYNH Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNA1 PE=1 SV=1
11	P14747	546	604	0.524	0.452	PP2B2_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CMP2 PE=1 SV=2
12	P16298	915	524	0.823	0.819	PP2BB_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP3CB PE=1 SV=2
13	P20651	917	525	0.821	0.815	PP2BB_RAT Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Rattus norvegicus OX=10116 GN=Ppp3cb PE=1 SV=1
14	P23287	528	553	0.495	0.467	PP2B1_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CNA1 PE=1 SV=2
15	P48452	1088	521	0.996	0.996	PP2BA_BOVIN Protein phosphatase 3 catalytic subunit alpha OS=Bos taurus OX=9913 GN=PPP3CA PE=1 SV=1
16	P48453	919	525	0.823	0.817	PP2BB_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Mus musculus OX=10090 GN=Ppp3cb PE=1 SV=2
17	P48454	884	512	0.787	0.801	PP2BC_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP3CC PE=1 SV=3
18	P48455	844	513	0.747	0.758	PP2BC_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Mus musculus OX=10090 GN=Ppp3cc PE=1 SV=1
19	P48456	784	622	0.706	0.592	PP2B1_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 1 OS=Drosophila melanogaster OX=7227 GN=CanA1 PE=2 SV=2
20	P48457	654	549	0.593	0.563	PP2B_EMENI Serine/threonine-protein phosphatase 2B catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cnaA PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00149 Metallophos	1.9e-35	134.8	Calcineurin-like phosphoesterase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000024305

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000012174	0.999	annotation not available
2	61853.ENSNLEP00000010154	0.996	Uncharacterized protein
3	61853.ENSNLEP00000020260	0.987	Protein phosphatase 3, catalytic subunit, beta isozyme
4	61853.ENSNLEP00000007753	0.974	Protein phosphatase 1, catalytic subunit, alpha isozyme
5	61853.ENSNLEP00000018622	0.974	Protein phosphatase 1, catalytic subunit, beta isozyme
6	61853.ENSNLEP00000020618	0.964	Calmodulin 2 (phosphorylase kinase, delta)
7	61853.ENSNLEP00000018908	0.955	Protein phosphatase 3, catalytic subunit, gamma isozyme
8	61853.ENSNLEP00000017713	0.940	TOX high mobility group box family member 4
9	61853.ENSNLEP00000018949	0.940	SHOC2, leucine rich repeat scaffold protein
10	61853.ENSNLEP00000003868	0.938	Protein phosphatase 1, catalytic subunit, gamma isozyme
11	61853.ENSNLEP00000001086	0.934	Protein phosphatase 1, regulatory (inhibitor) subunit 1B
12	61853.ENSNLEP00000019652	0.934	Protein phosphatase 2, regulatory subunit B, alpha
13	61853.ENSNLEP00000007292	0.931	Protein phosphatase 2, regulatory subunit A, alpha
14	61853.ENSNLEP00000023223	0.931	Protein phosphatase 1, regulatory subunit 10
15	61853.ENSNLEP00000008542	0.925	Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
16	61853.ENSNLEP00000006197	0.924	Uncharacterized protein
17	61853.ENSNLEP00000018195	0.924	Protein phosphatase 1, regulatory subunit 3B
18	61853.ENSNLEP00000005200	0.922	Regulator of calcineurin 1
19	61853.ENSNLEP00000006189	0.918	Protein phosphatase 1, regulatory subunit 12A
20	61853.ENSNLEP00000002579	0.917	Protein phosphatase 4, catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005516	1.000	calmodulin binding
GO:0004723	1.000	calcium-dependent protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016311	0.995	dephosphorylation
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0006807	0.976	nitrogen compound metabolic process
GO:0006470	0.968	protein dephosphorylation
GO:0050789	0.966	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0050896	0.592	response to stimulus
GO:0032501	0.472	multicellular organismal process
GO:0048518	0.342	positive regulation of biological process
GO:0019222	0.336	regulation of metabolic process
GO:0048522	0.326	positive regulation of cellular process
GO:0032502	0.318	developmental process
GO:0060255	0.305	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.996	intracellular organelle lumen
GO:0005654	0.990	nucleoplasm
GO:0016020	0.974	membrane
GO:0032991	0.971	protein-containing complex
GO:1902494	0.936	catalytic complex
GO:0005886	0.928	plasma membrane
GO:1903293	0.833	phosphatase complex
GO:0140535	0.806	intracellular protein-containing complex
GO:0008287	0.795	protein serine/threonine phosphatase complex
GO:0005955	0.791	calcineurin complex
GO:0030054	0.559	cell junction
GO:0043228	0.468	non-membrane-bounded organelle
GO:0043232	0.456	intracellular non-membrane-bounded organelle
GO:0045202	0.326	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]