StarFunc result for job id Q08211

User Input

>input (1270 residues)
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSN
AARDFVNYLVRINEIKSEEVPAFGVASPPPLTDTPDTTANAEGDLPTTMGGPLPPHLALK
AENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLEN
AKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQ
SCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPP
PEDPSVPVALNIGKLAQFEPSQRQNQVGVVPWSPPQSNWNPWTSSNIDEGPLAFATPEQI
SMDLKNELMYQLEQDHDLQAILQERELLPVKKFESEILEAISQNSVVIIRGATGCGKTTQ
VPQFILDDFIQNDRAAECNIVVTQPRRISAVSVAERVAFERGEEPGKSCGYSVRFESILP
RPHASIMFCTVGVLLRKLEAGIRGISHVIVDEIHERDINTDFLLVVLRDVVQAYPEVRIV
LMSATIDTSMFCEYFFNCPIIEVYGRTYPVQEYFLEDCIQMTHFVPPPKDKKKKDKDDDG
GEDDDANCNLICGDEYGPETRLSMSQLNEKETPFELIEALLKYIETLNVPGAVLVFLPGW
NLIYTMQKHLEMNPHFGSHRYQILPLHSQIPREEQRKVFDPVPVGVTKVILSTNIAETSI
TINDVVYVIDSCKQKVKLFTAHNNMTNYATVWASKTNLEQRKGRAGRVRPGFCFHLCSRA
RFERLETHMTPEMFRTPLHEIALSIKLLRLGGIGQFLAKAIEPPPLDAVIEAEHTLRELD
ALDANDELTPLGRILAKLPIEPRFGKMMIMGCIFYVGDAICTIAAATCFPEPFINEGKRL
GYIHRNFAGNRFSDHVALLSVFQAWDDARMGGEEAEIRFCEHKRLNMATLRMTWEAKVQL
KEILINSGFPEDCLLTQVFTNTGPDNNLDVVISLLAFGVYPNVCYHKEKRKILTTEGRNA
LIHKSSVNCPFSSQDMKYPSPFFVFGEKIRTRAISAKGMTLVTPLQLLLFASKKVQSDGQ
IVLVDDWIKLQISHEAAACITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISR
PSAAGINLMIGSTRYGDGPRPPKMARYDNGSGYRRGGSSYSGGGYGGGYSSGGYGSGGYG
GSANSFRAGYGAGVGGGYRGVSRGGFRGNSGGDYRGPSGGYRGSGGFQRGGGRGAYGTGY
FGQGRGGGGY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5aorA	0.746	0.935	0.000	1009	0.421	0.530	5aorA.pdb.gz	Structure of the RNA Helicase Mle Reveals the Molecular Mechanisms for Uridine Specificity and RNA-ATP Coupling.
2	AFDB:B0S6Z1	0.825	0.824	0.000	1271	0.769	0.768	B0S6Z1.pdb.gz
3	AFDB:O70133	0.880	0.811	0.000	1380	0.906	0.834	O70133.pdb.gz	DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus OX=10090 GN=Dhx9 PE=1 SV=2
4	AFDB:P24785	0.781	0.768	0.000	1293	0.509	0.500	P24785.pdb.gz	MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster OX=7227 GN=mle PE=1 SV=2
5	AFDB:Q22307	0.781	0.763	0.000	1301	0.429	0.419	Q22307.pdb.gz	DHX9_CAEEL ATP-dependent RNA helicase A OS=Caenorhabditis elegans OX=6239 GN=rha-1 PE=2 SV=3
6	AFDB:Q28141	0.811	0.801	0.000	1287	0.943	0.930	Q28141.pdb.gz	DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus OX=9913 GN=DHX9 PE=1 SV=1
7	AFDB:Q05B79	0.523	0.642	2.685E-67	1010	0.259	0.326	Q05B79.pdb.gz	DHX36_BOVIN ATP-dependent DNA/RNA helicase DHX36 OS=Bos taurus OX=9913 GN=DHX36 PE=1 SV=1
8	AFDB:F4ILR7	0.575	0.720	1.316E-65	995	0.259	0.331	F4ILR7.pdb.gz	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
9	AFDB:Q6P158	0.573	0.527	2.299E-64	1386	0.269	0.247	Q6P158.pdb.gz	DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2
10	AFDB:Q382X0	0.566	0.554	2.525E-64	1299	0.244	0.239	Q382X0.pdb.gz	Q382X0_TRYB2 RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3930 PE=4 SV=1
11	AFDB:Q99PU8	0.573	0.597	4.432E-64	1217	0.248	0.259	Q99PU8.pdb.gz	DHX30_MOUSE ATP-dependent RNA helicase DHX30 OS=Mus musculus OX=10090 GN=Dhx30 PE=1 SV=1
12	PDB:5vheA	0.551	0.791	9.771E-57	871	0.231	0.338	5vheA.pdb.gz	Structural basis of G-quadruplex unfolding by the DEAH/RHA helicase DHX36.
13	PDB:5n9dB	0.579	0.834	1.539E-53	866	0.225	0.330	5n9dB.pdb.gz	Molecular Mechanistic Insights into Drosophila DHX36-Mediated G-Quadruplex Unfolding: A Structure-Based Model.
14	PDB:6id1V	0.449	0.838	7.458E-40	663	0.148	0.284	6id1V.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
15	PDB:3kx2B	0.447	0.731	7.422E-39	755	0.174	0.293	3kx2B.pdb.gz	Structural basis for the function of DEAH helicases
16	PDB:5ylzW	0.436	0.766	8.152E-39	703	0.151	0.273	5ylzW.pdb.gz	Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
17	PDB:5xjcY	0.448	0.774	9.833E-39	713	0.158	0.282	5xjcY.pdb.gz	An Atomic Structure of the Human Spliceosome
18	PDB:7dcpx	0.452	0.830	5.076E-38	670	0.149	0.282	7dcpx.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
19	PDB:6ff7q	0.431	0.847	1.075E-37	625	0.153	0.310	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:5wsge	0.412	0.726	2.374E-36	679	0.151	0.283	5wsge.pdb.gz	Structure of a yeast step II catalytically activated spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70133	0.0	2223	1380	0.860	0.791	DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus OX=10090 GN=Dhx9 PE=1 SV=2
2	P24785	0.0	1210	1293	0.484	0.476	MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster OX=7227 GN=mle PE=1 SV=2
3	Q08211	0.0	2641	1270	1.000	1.000	DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4
4	Q22307	0.0	951	1301	0.421	0.411	DHX9_CAEEL ATP-dependent RNA helicase A OS=Caenorhabditis elegans OX=6239 GN=rha-1 PE=2 SV=3
5	Q28141	0.0	2258	1287	0.877	0.866	DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus OX=9913 GN=DHX9 PE=1 SV=1
6	Q8VHK9	5.15e-167	525	1001	0.233	0.296	DHX36_MOUSE ATP-dependent DNA/RNA helicase DHX36 OS=Mus musculus OX=10090 GN=Dhx36 PE=1 SV=2
7	Q05B79	4.42e-166	523	1010	0.238	0.299	DHX36_BOVIN ATP-dependent DNA/RNA helicase DHX36 OS=Bos taurus OX=9913 GN=DHX36 PE=1 SV=1
8	D4A2Z8	2.29e-165	521	1000	0.233	0.296	DHX36_RAT ATP-dependent DNA/RNA helicase DHX36 OS=Rattus norvegicus OX=10116 GN=Dhx36 PE=1 SV=1
9	Q9H2U1	4.73e-165	520	1008	0.239	0.301	DHX36_HUMAN ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=2
10	F4ILR7	4.65e-161	509	995	0.235	0.301	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
11	E7EWK3	3.63e-157	493	797	0.219	0.349	E7EWK3_HUMAN RNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=1
12	Q6P158	3.49e-144	474	1386	0.243	0.223	DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2
13	F4HYJ6	4.85e-140	459	1206	0.237	0.250	F4HYJ6_ARATH RNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g48650 PE=1 SV=1
14	Q8SWT2	1.09e-135	440	942	0.216	0.291	Q8SWT2_DROME GH12763p OS=Drosophila melanogaster OX=7227 GN=Rhau PE=1 SV=1
15	Q7Z478	4.20e-135	449	1369	0.228	0.212	DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens OX=9606 GN=DHX29 PE=1 SV=2
16	Q6PGC1	1.91e-129	434	1365	0.228	0.212	DHX29_MOUSE ATP-dependent RNA helicase DHX29 OS=Mus musculus OX=10090 GN=Dhx29 PE=1 SV=1
17	H7BXY3	1.67e-124	416	1166	0.203	0.221	H7BXY3_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DHX30 PE=1 SV=1
18	Q5BJS0	2.34e-124	416	1194	0.197	0.209	DHX30_RAT ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus OX=10116 GN=Dhx30 PE=1 SV=1
19	Q99PU8	4.71e-124	416	1217	0.198	0.206	DHX30_MOUSE ATP-dependent RNA helicase DHX30 OS=Mus musculus OX=10090 GN=Dhx30 PE=1 SV=1
20	Q7L2E3	4.73e-124	415	1194	0.203	0.216	DHX30_HUMAN ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	48	15.4	AAA domain
2	PF13245 AAA_19	2.7e+02	13.2	AAA domain
3	PF13401 AAA_22	1.1e+02	14.5	AAA domain
4	PF06745 ATPase	1.3e+02	13.3	KaiC
5	PF00270 DEAD	0.0033	28.7	DEAD/DEAH box helicase
6	PF03368 Dicer_dimer	1.5	20.3	Dicer dimerisation domain
7	PF00035 dsrm	9.2e-24	95.3	Double-stranded RNA binding motif
8	PF04408 HA2	1.1e-11	56.3	Helicase associated domain (HA2)
9	PF00271 Helicase_C	4.2e-12	57.8	Helicase conserved C-terminal domain
10	PF07717 OB_NTP_bind	7.7e-11	53.5	Oligonucleotide/oligosaccharide-binding (OB)-fold
11	PF02562 PhoH	2.4e+02	12.6	PhoH-like protein
12	PF04851 ResIII	79	14.7	Type III restriction enzyme, res subunit
13	PF00437 T2SSE	2.8e+02	12.0	Type II/IV secretion system protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356520

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220592	0.997	Protein argonaute-2
2	9606.ENSP00000400142	0.997	RNA-binding protein EWS
3	9606.ENSP00000418960	0.993	Breast cancer type 1 susceptibility protein
4	9606.ENSP00000283179	0.991	Heterogeneous nuclear ribonucleoprotein U
5	9606.ENSP00000437256	0.987	Endoribonuclease Dicer
6	9606.ENSP00000404121	0.983	Interleukin enhancer-binding factor 3
7	9606.ENSP00000361626	0.979	Nuclease-sensitive element-binding protein 1
8	9606.ENSP00000362300	0.977	Protein argonaute-1
9	9606.ENSP00000425561	0.974	Eukaryotic translation initiation factor 4E
10	9606.ENSP00000313007	0.972	Polyadenylate-binding protein 1
11	9606.ENSP00000358635	0.970	Heterogeneous nuclear ribonucleoprotein Q
12	9606.ENSP00000363314	0.970	Protein lin-28 homolog A
13	9606.ENSP00000368458	0.970	Proliferating cell nuclear antigen
14	9606.ENSP00000478754	0.970	Probable ATP-dependent RNA helicase DDX6
15	9606.ENSP00000313829	0.958	KH domain-containing, RNA-binding, signal transduction-associated protein 1
16	9606.ENSP00000401980	0.957	Mitochondrial antiviral-signaling protein
17	9606.ENSP00000401399	0.956	Myeloid differentiation primary response protein MyD88
18	9606.ENSP00000266987	0.951	RISC-loading complex subunit TARBP2
19	9606.ENSP00000290341	0.951	Insulin-like growth factor 2 mRNA-binding protein 1
20	9606.ENSP00000355011	0.951	Interleukin enhancer-binding factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	0.998	RNA binding
GO:0005515	0.997	protein binding
GO:0003724	0.997	RNA helicase activity
GO:0008094	0.989	ATP-dependent activity, acting on DNA
GO:0016462	0.988	pyrophosphatase activity
GO:0003678	0.983	DNA helicase activity
GO:0001069	0.955	regulatory region RNA binding
GO:0016887	0.896	ATP hydrolysis activity
GO:0043138	0.892	3'-5' DNA helicase activity
GO:0003677	0.867	DNA binding
GO:0003725	0.356	double-stranded RNA binding
GO:0061980	0.353	regulatory RNA binding
GO:0035197	0.301	siRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0071840	0.976	cellular component organization or biogenesis
GO:0016043	0.969	cellular component organization
GO:0065007	0.952	biological regulation
GO:0050789	0.940	regulation of biological process
GO:0019222	0.923	regulation of metabolic process
GO:0060255	0.878	regulation of macromolecule metabolic process
GO:0008152	0.877	metabolic process
GO:0044238	0.870	primary metabolic process
GO:0006807	0.862	nitrogen compound metabolic process
GO:0071704	0.845	organic substance metabolic process
GO:0006996	0.842	organelle organization
GO:0044237	0.835	cellular metabolic process
GO:0043170	0.786	macromolecule metabolic process
GO:0034641	0.786	cellular nitrogen compound metabolic process
GO:0032508	0.762	DNA duplex unwinding
GO:0050794	0.720	regulation of cellular process
GO:0010468	0.709	regulation of gene expression
GO:0048518	0.634	positive regulation of biological process
GO:0050896	0.586	response to stimulus
GO:0080090	0.539	regulation of primary metabolic process
GO:0046483	0.538	heterocycle metabolic process
GO:0006139	0.528	nucleobase-containing compound metabolic process
GO:0090304	0.478	nucleic acid metabolic process
GO:0051171	0.473	regulation of nitrogen compound metabolic process
GO:0031323	0.452	regulation of cellular metabolic process
GO:0009893	0.446	positive regulation of metabolic process
GO:0010604	0.429	positive regulation of macromolecule metabolic process
GO:0010467	0.418	gene expression
GO:0006396	0.327	RNA processing
GO:0019219	0.323	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.312	regulation of RNA metabolic process
GO:0048522	0.306	positive regulation of cellular process
GO:0048519	0.305	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005654	0.999	nucleoplasm
GO:0032991	0.979	protein-containing complex
GO:0005829	0.975	cytosol
GO:1990904	0.859	ribonucleoprotein complex
GO:1902494	0.787	catalytic complex
GO:0005730	0.705	nucleolus
GO:0016020	0.456	membrane
GO:0005694	0.449	chromosome
GO:0140535	0.434	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.997	RNA helicase.
EC:3.6.1.-	0.988	In phosphorus-containing anhydrides.
RHEA:13065	0.896	ATP + H2O = ADP + H(+) + phosphate
EC:5.6.2.4	0.892	DNA 3'-5' helicase.

[back to server]