StarFunc result for job id Q08257

User Input

>input (329 residues)
MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYS
RKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEK
LDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTA
GTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHG
GRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIG
SQYPLEKVAEAHENIIHGSGATGKMILLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08257	1.000	1.000	4.870E-77	329	1.000	1.000	Q08257.pdb.gz	QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ PE=1 SV=1
2	AFDB:O97764	0.998	0.995	1.048E-69	330	0.875	0.873	O97764.pdb.gz	QOR_BOVIN Zeta-crystallin OS=Bos taurus OX=9913 GN=CRYZ PE=2 SV=2
3	AFDB:P11415	0.997	0.997	5.846E-69	329	0.830	0.830	P11415.pdb.gz	QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus OX=10141 GN=CRYZ PE=1 SV=1
4	PDB:1yb5A	0.980	0.995	1.095E-68	324	0.985	1.000	1yb5A.pdb.gz	Crystal Structure of human Zeta-Crystallin at 1.85A
5	AFDB:Q6AYT0	0.996	0.996	4.713E-66	329	0.809	0.809	Q6AYT0.pdb.gz	QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus OX=10116 GN=Cryz PE=2 SV=1
6	AFDB:Q3UNZ8	0.933	0.879	9.499E-35	350	0.280	0.263	Q3UNZ8.pdb.gz	QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus OX=10090 GN=Cryzl2 PE=1 SV=1
7	AFDB:A1L4Y4	0.897	0.736	8.661E-34	406	0.292	0.236	A1L4Y4.pdb.gz	A1L4Y4_ARATH At5g61510 OS=Arabidopsis thaliana OX=3702 GN=At5g61510 PE=1 SV=1
8	PDB:6k9yA	0.886	0.854	1.623E-33	342	0.322	0.310	6k9yA.pdb.gz
9	AFDB:Q3MIE4	0.895	0.737	2.957E-33	404	0.334	0.272	Q3MIE4.pdb.gz	VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus OX=10116 GN=Vat1 PE=1 SV=1
10	AFDB:O53146	0.877	0.879	3.144E-33	328	0.310	0.311	O53146.pdb.gz	O53146_MYCTU Probable quinone reductase Qor (NADPH:quinone reductase) (Zeta-crystallin homolog protein) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=qor PE=1 SV=3
11	PDB:4rvuA	0.885	0.885	6.264E-33	329	0.313	0.313	4rvuA.pdb.gz	Structural views of quinone oxidoreductase from Mycobacterium tuberculosis reveal large conformational changes induced by the co-factor.
12	AFDB:Q9HCJ6	0.896	0.711	8.930E-33	419	0.313	0.246	Q9HCJ6.pdb.gz	VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens OX=9606 GN=VAT1L PE=1 SV=2
13	AFDB:O65423	0.880	0.890	1.142E-32	325	0.313	0.317	O65423.pdb.gz	O65423_ARATH AT4g21580/F18E5_200 OS=Arabidopsis thaliana OX=3702 GN=F18E5.200 PE=1 SV=1
14	PDB:2obyA	0.891	0.878	8.512E-31	334	0.289	0.284	2obyA.pdb.gz	Crystal structure of human P53 inducible oxidoreductase (TP53I3, PIG3)
15	PDB:1qorA	0.872	0.879	1.308E-30	326	0.286	0.288	1qorA.pdb.gz	Crystal structure of Escherichia coli QOR quinone oxidoreductase complexed with NADPH.
16	PDB:3qwaB	0.841	0.834	1.088E-28	332	0.252	0.250	3qwaB.pdb.gz
17	PDB:5a3jC	0.816	0.821	4.748E-28	327	0.301	0.303	5a3jC.pdb.gz	Crystal Structure of the Chloroplastic Oxoene Reductase ceQORH from Arabidopsis thaliana.
18	PDB:1zsyA	0.846	0.805	5.205E-27	347	0.225	0.213	1zsyA.pdb.gz
19	PDB:1wlyA	0.792	0.807	5.885E-27	322	0.267	0.273	1wlyA.pdb.gz
20	PDB:5envA	0.843	0.802	1.348E-25	347	0.240	0.228	5envA.pdb.gz	Mechanistic implications from structures of yeast alcohol dehydrogenase complexed with coenzyme and an alcohol.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O97764	0.0	600	330	0.875	0.873	QOR_BOVIN Zeta-crystallin OS=Bos taurus OX=9913 GN=CRYZ PE=2 SV=2
2	P11415	0.0	587	329	0.830	0.830	QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus OX=10141 GN=CRYZ PE=1 SV=1
3	Q08257	0.0	669	329	1.000	1.000	QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ PE=1 SV=1
4	Q6AYT0	0.0	560	329	0.809	0.809	QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus OX=10116 GN=Cryz PE=2 SV=1
5	O65423	1.62e-43	154	325	0.319	0.323	O65423_ARATH AT4g21580/F18E5_200 OS=Arabidopsis thaliana OX=3702 GN=F18E5.200 PE=1 SV=1
6	Q9HCJ6	1.82e-43	156	419	0.343	0.270	VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens OX=9606 GN=VAT1L PE=1 SV=2
7	A1L4Y4	6.07e-42	152	406	0.298	0.241	A1L4Y4_ARATH At5g61510 OS=Arabidopsis thaliana OX=3702 GN=At5g61510 PE=1 SV=1
8	Q99536	7.47e-41	149	393	0.334	0.280	VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 PE=1 SV=2
9	P95185	4.99e-39	142	323	0.304	0.310	P95185_MYCTU Probable NADPH quinone oxidoreductase FadB4 (NADPH:quinone reductase) (Zeta-crystallin) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadB4 PE=1 SV=1
10	P28304	2.45e-38	140	327	0.301	0.303	QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) OX=83333 GN=qorA PE=1 SV=1
11	O74489	6.65e-37	137	329	0.313	0.313	QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=zta1 PE=1 SV=2
12	Q3MIE4	4.05e-36	136	404	0.325	0.265	VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus OX=10116 GN=Vat1 PE=1 SV=1
13	O53146	1.45e-35	133	328	0.313	0.314	O53146_MYCTU Probable quinone reductase Qor (NADPH:quinone reductase) (Zeta-crystallin homolog protein) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=qor PE=1 SV=3
14	P72043	4.90e-35	132	328	0.271	0.271	P72043_MYCTU Probable oxidoreductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3777 PE=1 SV=2
15	Q3UNZ8	4.95e-35	132	350	0.274	0.257	QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus OX=10090 GN=Cryzl2 PE=1 SV=1
16	Q582N8	1.30e-33	128	339	0.313	0.304	Q582N8_TRYB2 Oxidoreductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.760 PE=4 SV=1
17	Q53FA7	1.55e-27	112	332	0.280	0.277	QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens OX=9606 GN=TP53I3 PE=1 SV=2
18	Q9ZGI4	7.15e-27	114	3739	0.271	0.024	PIKA2_STRVZ Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 OS=Streptomyces venezuelae OX=54571 GN=pikAII PE=1 SV=1
19	Q9ZUC1	1.09e-26	110	386	0.307	0.262	AOR_ARATH NADPH-dependent alkenal/one oxidoreductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AOR PE=1 SV=2
20	Q59I44	8.74e-26	107	333	0.274	0.270	CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. OX=36773 GN=caa43 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08240 ADH_N	1.8e-08	45.6	Alcohol dehydrogenase GroES-like domain
2	PF16884 ADH_N_2	1.9e+02	13.4	N-terminal domain of oxidoreductase
3	PF00107 ADH_zinc_N	4.1e-22	90.0	Zinc-binding dehydrogenase
4	PF13602 ADH_zinc_N_2	1.5e-16	73.1	Zinc-binding dehydrogenase
5	PF01113 DapB_N	1.7e+02	13.7	Dihydrodipicolinate reductase, N-terminus
6	PF12242 Eno-Rase_NADH_b	1.8e+02	13.3	NAD(P)H binding domain of trans-2-enoyl-CoA reductase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399805

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380252	0.972	Nuclear factor erythroid 2-related factor 2
2	9606.ENSP00000360266	0.926	Transcription factor AP-1
3	9606.ENSP00000306245	0.914	Proto-oncogene c-Fos
4	9606.ENSP00000387699	0.908	Cyclic AMP-responsive element-binding protein 1
5	9606.ENSP00000292079	0.900	Sodium/potassium-transporting ATPase subunit gamma
6	9606.ENSP00000319788	0.882	NAD(P)H dehydrogenase [quinone] 1
7	9606.ENSP00000244217	0.832	Methylmalonyl-CoA epimerase, mitochondrial
8	9606.ENSP00000216117	0.822	Heme oxygenase 1
9	9606.ENSP00000171111	0.717	Kelch-like ECH-associated protein 1
10	9606.ENSP00000260324	0.712	Sulfide:quinone oxidoreductase, mitochondrial
11	9606.ENSP00000215939	0.705	Beta-crystallin B1
12	9606.ENSP00000369822	0.691	Ribosyldihydronicotinamide dehydrogenase [quinone]
13	9606.ENSP00000215855	0.690	Beta-crystallin B3
14	9606.ENSP00000241052	0.680	Catalase
15	9606.ENSP00000303356	0.679	L-xylulose reductase
16	9606.ENSP00000381273	0.654	Beta-crystallin B2
17	9606.ENSP00000229416	0.645	Glutamate-cysteine ligase catalytic subunit
18	9606.ENSP00000295256	0.644	Hematopoietic prostaglandin D synthase
19	9606.ENSP00000346805	0.638	Beta-crystallin A4
20	9606.ENSP00000434516	0.638	Thioredoxin reductase 1, cytoplasmic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016655	0.999	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
GO:0050661	0.999	NADP binding
GO:0043168	0.997	anion binding
GO:0005515	0.996	protein binding
GO:0016616	0.922	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0042802	0.902	identical protein binding
GO:0003676	0.830	nucleic acid binding
GO:0070402	0.808	NADPH binding
GO:0003730	0.732	mRNA 3'-UTR binding
GO:0003960	0.433	NADPH:quinone reductase activity
GO:0016628	0.331	oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009056	0.995	catabolic process
GO:0044237	0.995	cellular metabolic process
GO:0071704	0.936	organic substance metabolic process
GO:0044248	0.888	cellular catabolic process
GO:0050896	0.646	response to stimulus
GO:0044281	0.560	small molecule metabolic process
GO:0042221	0.438	response to chemical
GO:0051716	0.411	cellular response to stimulus
GO:0070887	0.385	cellular response to chemical stimulus
GO:0032501	0.384	multicellular organismal process
GO:0044238	0.364	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.963	membrane-bounded organelle
GO:0005576	0.949	extracellular region
GO:0031982	0.870	vesicle
GO:0005615	0.859	extracellular space
GO:0070062	0.850	extracellular exosome
GO:0043229	0.848	intracellular organelle
GO:0043231	0.825	intracellular membrane-bounded organelle
GO:0043233	0.487	organelle lumen
GO:0070013	0.433	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.6.5.-	0.999	With a quinone or similar compound as acceptor.
EC:1.1.1.-	0.922	With NAD(+) or NADP(+) as acceptor.
RHEA:14269	0.433	2 a quinone + H(+) + NADPH = 2 a 1,4-benzosemiquinone + NADP(+)
EC:1.6.5.5	0.433	NADPH:quinone reductase.
EC:1.3.1.-	0.331	With NAD(+) or NADP(+) as acceptor.

[back to server]