StarFunc result for job id Q08289

User Input

>input (660 residues)
MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQSYGKGARRKNRFKGSDGSTS
SDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVR
TNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLE
NMRLQHEQRAKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAEENDIP
ANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMM
QKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIER
IFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLN
VQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSSSLPNPLLSRTL
ATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHN
HRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDH
RHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVISKKRNEAGEWNRDVYIRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08289	1.000	1.000	0.000	660	1.000	1.000	Q08289.pdb.gz	CACB2_HUMAN Voltage-dependent L-type calcium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=CACNB2 PE=1 SV=3
2	AFDB:P19517	0.540	0.673	1.640E-65	524	0.553	0.697	P19517.pdb.gz	CACB1_RABIT Voltage-dependent L-type calcium channel subunit beta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNB1 PE=1 SV=1
3	AFDB:B2XY77	0.501	0.551	7.681E-65	599	0.529	0.583	B2XY77.pdb.gz
4	AFDB:F1R605	0.486	0.613	4.842E-64	520	0.558	0.708	F1R605.pdb.gz
5	AFDB:O00305	0.487	0.614	2.268E-63	520	0.527	0.669	O00305.pdb.gz	CACB4_HUMAN Voltage-dependent L-type calcium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=CACNB4 PE=1 SV=2
6	AFDB:B0F0D1	0.486	0.610	2.330E-61	523	0.509	0.642	B0F0D1.pdb.gz	B0F0D1_DANRE Calcium channel, voltage-dependent, beta 4b subunit OS=Danio rerio OX=7955 GN=cacnb4.1 PE=2 SV=1
7	AFDB:B0F0D0	0.492	0.621	4.539E-60	519	0.521	0.663	B0F0D0.pdb.gz	B0F0D0_DANRE Calcium channel, voltage-dependent, beta 4a subunit OS=Danio rerio OX=7955 GN=cacnb4.2 PE=2 SV=1
8	AFDB:M9PD84	0.486	0.383	3.355E-56	844	0.456	0.357	M9PD84.pdb.gz	M9PD84_DROME Ca2+-channel-protein-beta-subunit, isoform L OS=Drosophila melanogaster OX=7227 GN=Ca-beta PE=3 SV=1
9	AFDB:O01661	0.480	0.598	5.085E-56	526	0.441	0.553	O01661.pdb.gz	O01661_CAEEL Guanylate kinase/L-type calcium channel beta subunit domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccb-1 PE=1 SV=2
10	AFDB:P54284	0.494	0.669	1.115E-54	484	0.452	0.616	P54284.pdb.gz	CACB3_HUMAN Voltage-dependent L-type calcium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=CACNB3 PE=1 SV=1
11	PDB:7mixC	0.430	0.857	8.413E-40	324	0.377	0.769	7mixC.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
12	PDB:6jpaC	0.267	0.977	5.193E-23	178	0.244	0.904	6jpaC.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
13	PDB:2xkxA	0.177	0.165	4.396E-9	721	0.100	0.092	2xkxA.pdb.gz
14	PDB:4f4jA	0.192	0.592	4.121E-5	189	0.052	0.180	4f4jA.pdb.gz
15	PDB:6nuiA	0.200	0.565	4.373E-5	198	0.056	0.187	6nuiA.pdb.gz
16	PDB:1lvgA	0.189	0.573	5.886E-5	190	0.064	0.221	1lvgA.pdb.gz	Structural characterization of the closed conformation of mouse guanylate kinase.
17	PDB:1z8fA	0.185	0.560	2.048E-4	184	0.055	0.196	1z8fA.pdb.gz
18	PDB:2c95A	0.175	0.481	2.794E-3	195	0.030	0.103	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
19	PDB:3qwyA	0.077	0.287	5.699E-3	170	0.020	0.076	3qwyA.pdb.gz
20	PDB:2yhsA	0.130	0.235	8.138E-3	308	0.048	0.104	2yhsA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A2SZ54	649	598	0.503	0.555	A2SZ54_DANRE Voltage-dependent L-type calcium channel subunit beta-2 OS=Danio rerio OX=7955 GN=cacnb2b PE=2 SV=1
2	A8WHZ5	565	485	0.503	0.685	A8WHZ5_DANRE Voltage-dependent L-type calcium channel subunit beta-3 OS=Danio rerio OX=7955 GN=cacnb4.2 PE=2 SV=1
3	B0F0C6	569	489	0.495	0.669	B0F0C6_DANRE Calcium channel, voltage-dependent, beta 4b subunit OS=Danio rerio OX=7955 GN=cacnb4.1 PE=2 SV=1
4	B0F0D0	583	519	0.524	0.667	B0F0D0_DANRE Calcium channel, voltage-dependent, beta 4a subunit OS=Danio rerio OX=7955 GN=cacnb4.2 PE=2 SV=1
5	B0F0D1	589	523	0.517	0.652	B0F0D1_DANRE Calcium channel, voltage-dependent, beta 4b subunit OS=Danio rerio OX=7955 GN=cacnb4.1 PE=2 SV=1
6	D4A055	630	519	0.538	0.684	CACB4_RAT Voltage-dependent L-type calcium channel subunit beta-4 OS=Rattus norvegicus OX=10116 GN=Cacnb4 PE=1 SV=2
7	M9PD84	552	844	0.430	0.336	M9PD84_DROME Ca2+-channel-protein-beta-subunit, isoform L OS=Drosophila melanogaster OX=7227 GN=Ca-beta PE=3 SV=1
8	O00305	631	520	0.535	0.679	CACB4_HUMAN Voltage-dependent L-type calcium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=CACNB4 PE=1 SV=2
9	P19517	673	524	0.539	0.679	CACB1_RABIT Voltage-dependent L-type calcium channel subunit beta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNB1 PE=1 SV=1
10	P54283	694	597	0.609	0.673	CACB1_RAT Voltage-dependent L-type calcium channel subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Cacnb1 PE=1 SV=1
11	P54284	544	484	0.476	0.649	CACB3_HUMAN Voltage-dependent L-type calcium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=CACNB3 PE=1 SV=1
12	P54285	550	484	0.480	0.655	CACB3_MOUSE Voltage-dependent L-type calcium channel subunit beta-3 OS=Mus musculus OX=10090 GN=Cacnb3 PE=1 SV=2
13	P54287	546	484	0.476	0.649	CACB3_RAT Voltage-dependent L-type calcium channel subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Cacnb3 PE=1 SV=1
14	P54288	1260	632	0.921	0.962	CACB2_RABIT Voltage-dependent L-type calcium channel subunit beta-2 OS=Oryctolagus cuniculus OX=9986 GN=CACNB2 PE=1 SV=1
15	Q02641	689	598	0.612	0.676	CACB1_HUMAN Voltage-dependent L-type calcium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=CACNB1 PE=1 SV=3
16	Q08289	1363	660	1.000	1.000	CACB2_HUMAN Voltage-dependent L-type calcium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=CACNB2 PE=1 SV=3
17	Q2Q551	676	603	0.632	0.692	Q2Q551_DANRE Voltage-dependent L-type calcium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:91982 PE=2 SV=1
18	Q6DG31	627	478	0.539	0.745	Q6DG31_DANRE Voltage-dependent L-type calcium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:91982 PE=2 SV=1
19	Q8CC27	1176	655	0.938	0.945	CACB2_MOUSE Voltage-dependent L-type calcium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Cacnb2 PE=1 SV=1
20	Q8R0S4	629	519	0.538	0.684	CACB4_MOUSE Voltage-dependent L-type calcium channel subunit beta-4 OS=Mus musculus OX=10090 GN=Cacnb4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00625 Guanylate_kin	2.4e-46	169.2	Guanylate kinase
2	PF00018 SH3_1	6.9	17.7	SH3 domain
3	PF07653 SH3_2	3.9e+02	12.3	Variant SH3 domain
4	PF12052 VGCC_beta4Aa_N	1.3e-19	81.3	Voltage gated calcium channel subunit beta domain 4Aa N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320025

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266376	0.998	Voltage-dependent L-type calcium channel subunit alpha-1C
2	9606.ENSP00000349320	0.997	Voltage-dependent calcium channel subunit alpha-2/delta-1
3	9606.ENSP00000355192	0.991	Voltage-dependent L-type calcium channel subunit alpha-1S
4	9606.ENSP00000288139	0.982	Voltage-dependent L-type calcium channel subunit alpha-1D
5	9606.ENSP00000418081	0.958	Voltage-dependent calcium channel subunit alpha-2/delta-2
6	9606.ENSP00000365441	0.957	Voltage-dependent L-type calcium channel subunit alpha-1F
7	9606.ENSP00000372169	0.946	Voltage-dependent calcium channel subunit alpha-2/delta-4
8	9606.ENSP00000360423	0.934	Voltage-dependent N-type calcium channel subunit alpha-1B
9	9606.ENSP00000254976	0.924	Synaptosomal-associated protein 25
10	9606.ENSP00000346265	0.917	Synaptotagmin-5
11	9606.ENSP00000301050	0.916	Voltage-dependent L-type calcium channel subunit beta-3
12	9606.ENSP00000371594	0.915	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
13	9606.ENSP00000353362	0.912	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
14	9606.ENSP00000356545	0.912	Voltage-dependent R-type calcium channel subunit alpha-1E
15	9606.ENSP00000229264	0.910	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
16	9606.ENSP00000314214	0.906	Vesicle-associated membrane protein 2
17	9606.ENSP00000380432	0.905	Insulin
18	9606.ENSP00000232564	0.903	Guanine nucleotide-binding protein subunit beta-4
19	9606.ENSP00000222812	0.902	Syntaxin-1A
20	9606.ENSP00000294117	0.902	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005245	1.000	voltage-gated calcium channel activity
GO:0008331	0.928	high voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0009987	0.982	cellular process
GO:0043269	0.960	regulation of monoatomic ion transport
GO:0032501	0.945	multicellular organismal process
GO:0050794	0.944	regulation of cellular process
GO:0010959	0.936	regulation of metal ion transport
GO:0007154	0.934	cell communication
GO:0051924	0.934	regulation of calcium ion transport
GO:0023052	0.928	signaling
GO:1904062	0.906	regulation of monoatomic cation transmembrane transport
GO:0042391	0.903	regulation of membrane potential
GO:0032412	0.891	regulation of monoatomic ion transmembrane transporter activity
GO:0003012	0.888	muscle system process
GO:0051179	0.887	localization
GO:0008016	0.885	regulation of heart contraction
GO:2001257	0.874	regulation of cation channel activity
GO:0006936	0.865	muscle contraction
GO:0098916	0.857	anterograde trans-synaptic signaling
GO:1903169	0.855	regulation of calcium ion transmembrane transport
GO:0048518	0.814	positive regulation of biological process
GO:1901385	0.798	regulation of voltage-gated calcium channel activity
GO:1904064	0.796	positive regulation of cation transmembrane transport
GO:0006811	0.789	monoatomic ion transport
GO:0030001	0.770	metal ion transport
GO:0006816	0.755	calcium ion transport
GO:0061337	0.738	cardiac conduction
GO:1904427	0.736	positive regulation of calcium ion transmembrane transport
GO:0050896	0.698	response to stimulus
GO:0007268	0.676	chemical synaptic transmission
GO:0001508	0.661	action potential
GO:0032414	0.652	positive regulation of ion transmembrane transporter activity
GO:0071840	0.614	cellular component organization or biogenesis
GO:0016043	0.602	cellular component organization
GO:0086065	0.592	cell communication involved in cardiac conduction
GO:0051641	0.533	cellular localization
GO:0051716	0.436	cellular response to stimulus
GO:0008015	0.406	blood circulation
GO:0006941	0.395	striated muscle contraction
GO:0003015	0.392	heart process
GO:0060047	0.372	heart contraction
GO:0086001	0.337	cardiac muscle cell action potential
GO:0060048	0.334	cardiac muscle contraction
GO:0034220	0.315	monoatomic ion transmembrane transport
GO:0002027	0.305	regulation of heart rate

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005891	0.999	voltage-gated calcium channel complex
GO:0030315	0.863	T-tubule
GO:0005622	0.718	intracellular anatomical structure
GO:0005737	0.712	cytoplasm
GO:0043226	0.707	organelle
GO:0043227	0.702	membrane-bounded organelle
GO:0030054	0.348	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]