StarFunc result for job id Q08334

User Input

>input (325 residues)
MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYR
IFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQV
EVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRN
LEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLG
CFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAE
DSESGKQNPGDSCSLGTPPGQGPQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08334	1.000	1.000	1.860E-57	325	1.000	1.000	Q08334.pdb.gz	I10R2_HUMAN Interleukin-10 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL10RB PE=1 SV=2
2	AFDB:Q61190	0.831	0.776	1.209E-45	349	0.689	0.642	Q61190.pdb.gz	I10R2_MOUSE Interleukin-10 receptor subunit beta OS=Mus musculus OX=10090 GN=Il10rb PE=1 SV=1
3	AFDB:K7NA32	0.566	0.461	4.595E-25	405	0.258	0.207	K7NA32.pdb.gz	IRA1A_ONCMY Interferon alpha/beta receptor 1a OS=Oncorhynchus mykiss OX=8022 GN=ifnar1a PE=2 SV=1
4	AFDB:A0FJI0	0.584	0.520	6.005E-25	368	0.243	0.215	A0FJI0.pdb.gz
5	AFDB:Q9UHF4	0.567	0.345	1.848E-21	553	0.274	0.161	Q9UHF4.pdb.gz	I20RA_HUMAN Interleukin-20 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL20RA PE=1 SV=2
6	AFDB:D4A109	0.516	0.509	1.340E-20	330	0.246	0.242	D4A109.pdb.gz	D4A109_RAT Interferon gamma receptor 2 OS=Rattus norvegicus OX=10116 GN=Ifngr2 PE=4 SV=1
7	AFDB:Q6PHB0	0.556	0.341	1.491E-20	546	0.246	0.147	Q6PHB0.pdb.gz	I20RA_MOUSE Interleukin-20 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il20ra PE=2 SV=2
8	AFDB:P38484	0.510	0.493	4.590E-20	337	0.240	0.231	P38484.pdb.gz	INGR2_HUMAN Interferon gamma receptor 2 OS=Homo sapiens OX=9606 GN=IFNGR2 PE=1 SV=2
9	AFDB:Q3UVK9	0.521	0.511	7.045E-20	332	0.234	0.229	Q3UVK9.pdb.gz	Q3UVK9_MOUSE Fibronectin type-III domain-containing protein OS=Mus musculus OX=10090 GN=Ifngr2 PE=2 SV=1
10	AFDB:P17181	0.481	0.306	2.414E-19	557	0.243	0.142	P17181.pdb.gz	INAR1_HUMAN Interferon alpha/beta receptor 1 OS=Homo sapiens OX=9606 GN=IFNAR1 PE=1 SV=3
11	PDB:7u7nC	0.445	0.673	1.702E-11	200	0.117	0.190	7u7nC.pdb.gz
12	PDB:7z0lB	0.403	0.361	4.965E-10	370	0.142	0.124	7z0lB.pdb.gz
13	PDB:3besR	0.451	0.567	5.238E-10	250	0.105	0.136	3besR.pdb.gz
14	PDB:5mj3A	0.349	0.371	8.944E-8	302	0.098	0.106	5mj3A.pdb.gz
15	PDB:6pxvA	0.262	0.120	4.226E-7	823	0.138	0.055	6pxvA.pdb.gz
16	PDB:8eyyA	0.261	0.127	1.372E-6	775	0.138	0.058	8eyyA.pdb.gz
17	PDB:8dtlA	0.252	0.124	9.952E-6	741	0.148	0.065	8dtlA.pdb.gz
18	PDB:6pyhD	0.276	0.135	1.169E-5	798	0.111	0.045	6pyhD.pdb.gz
19	PDB:7bwaA	0.283	0.153	1.793E-4	674	0.098	0.047	7bwaA.pdb.gz
20	PDB:6xi2A	0.229	0.146	2.221E-4	528	0.052	0.032	6xi2A.pdb.gz	Crystal structures of beta-1,4-N-acetylglucosaminyltransferase 2: structural basis for inherited muscular dystrophies.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08334	0.0	683	325	1.000	1.000	I10R2_HUMAN Interleukin-10 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL10RB PE=1 SV=2
2	Q61190	1.15e-173	487	349	0.689	0.642	I10R2_MOUSE Interleukin-10 receptor subunit beta OS=Mus musculus OX=10090 GN=Il10rb PE=1 SV=1
3	K7NA32	1.10e-22	99.8	405	0.249	0.200	IRA1A_ONCMY Interferon alpha/beta receptor 1a OS=Oncorhynchus mykiss OX=8022 GN=ifnar1a PE=2 SV=1
4	K7NAJ3	1.94e-20	93.2	388	0.243	0.204	IRA1B_ONCMY Interferon alpha/beta receptor 1b OS=Oncorhynchus mykiss OX=8022 GN=ifnar1b PE=2 SV=1
5	P17181	4.15e-20	93.2	557	0.243	0.142	INAR1_HUMAN Interferon alpha/beta receptor 1 OS=Homo sapiens OX=9606 GN=IFNAR1 PE=1 SV=3
6	D4A109	2.11e-19	89.4	330	0.249	0.245	D4A109_RAT Interferon gamma receptor 2 OS=Rattus norvegicus OX=10116 GN=Ifngr2 PE=4 SV=1
7	Q9UHF4	2.88e-19	90.5	553	0.258	0.152	I20RA_HUMAN Interleukin-20 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL20RA PE=1 SV=2
8	P38484	4.20e-19	88.6	337	0.240	0.231	INGR2_HUMAN Interferon gamma receptor 2 OS=Homo sapiens OX=9606 GN=IFNGR2 PE=1 SV=2
9	P33896	1.19e-16	82.8	590	0.188	0.103	INAR1_MOUSE Interferon alpha/beta receptor 1 OS=Mus musculus OX=10090 GN=Ifnar1 PE=1 SV=2
10	Q63953	1.74e-16	80.9	332	0.249	0.244	Q63953_MOUSE Ifngr2 protein OS=Mus musculus OX=10090 GN=Ifngr2 PE=1 SV=1
11	Q3UVK9	3.77e-16	80.1	332	0.249	0.244	Q3UVK9_MOUSE Fibronectin type-III domain-containing protein OS=Mus musculus OX=10090 GN=Ifngr2 PE=2 SV=1
12	Q6PHB0	3.12e-14	75.5	546	0.200	0.119	I20RA_MOUSE Interleukin-20 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il20ra PE=2 SV=2
13	Q6UXL0	1.92e-13	72.0	311	0.215	0.225	I20RB_HUMAN Interleukin-20 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL20RB PE=1 SV=1
14	D3ZDS9	4.23e-13	72.0	593	0.172	0.094	D3ZDS9_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=2
15	A0A8I6AH72	4.34e-13	72.0	582	0.172	0.096	A0A8I6AH72_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=1
16	A0FJH7	9.12e-12	68.2	546	0.206	0.123	A0FJH7_DANRE cytokine receptor family member B1 OS=Danio rerio OX=7955 GN=fa94a03 PE=2 SV=1
17	E9Q9A6	1.43e-10	63.5	308	0.209	0.221	E9Q9A6_MOUSE Interleukin 20 receptor beta OS=Mus musculus OX=10090 GN=Il20rb PE=4 SV=1
18	B0UY88	1.78e-10	63.2	288	0.200	0.226	B0UY88_DANRE Tissue factor OS=Danio rerio OX=7955 GN=zgc:112151 PE=3 SV=1
19	A0A142K3A7	2.84e-10	62.4	302	0.206	0.222	A0A142K3A7_MOUSE Interleukin-20 receptor subunit beta OS=Mus musculus OX=10090 GN=Il20rb PE=2 SV=1
20	A0A0G2JXD8	6.11e-10	62.4	439	0.237	0.175	A0A0G2JXD8_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	41	15.9	Fibronectin type III domain
2	PF09294 Interfer-bind	4.5e-26	102.5	Interferon-alpha/beta receptor, fibronectin type III
3	PF06716 MP_p6	9.3e+02	11.3	Movement protein p6
4	PF01108 Tissue_fac	5.9e-12	56.8	Tissue factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290200

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227752	0.999	Interleukin-10 receptor subunit alpha
2	9606.ENSP00000270800	0.999	Interleukin-22 receptor subunit alpha-1
3	9606.ENSP00000327824	0.999	Interferon lambda receptor 1
4	9606.ENSP00000412237	0.999	Interleukin-10
5	9606.ENSP00000442424	0.999	Interleukin-22
6	9606.ENSP00000431885	0.998	Non-receptor tyrosine-protein kinase TYK2
7	9606.ENSP00000409000	0.997	Interferon lambda-3
8	9606.ENSP00000343204	0.993	Tyrosine-protein kinase JAK1
9	9606.ENSP00000329991	0.981	Interferon lambda-1
10	9606.ENSP00000333639	0.961	Interferon lambda-2
11	9606.ENSP00000229134	0.956	Interleukin-26
12	9606.ENSP00000351908	0.900	Mitogen-activated protein kinase kinase kinase 5
13	9606.ENSP00000296980	0.897	Interleukin-22 receptor subunit alpha-2
14	9606.ENSP00000314976	0.869	Interleukin-20 receptor subunit alpha
15	9606.ENSP00000343000	0.863	Interleukin-19
16	9606.ENSP00000264657	0.860	Signal transducer and activator of transcription 3
17	9606.ENSP00000354394	0.858	Signal transducer and activator of transcription 1-alpha/beta
18	9606.ENSP00000276927	0.839	Interferon alpha-1/13
19	9606.ENSP00000357981	0.839	Cathepsin S
20	9606.ENSP00000375795	0.837	Interleukin-24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	1.000	cytokine receptor activity
GO:0004920	0.348	interleukin-10 receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0002376	0.989	immune system process
GO:0007154	0.988	cell communication
GO:0023052	0.987	signaling
GO:0048518	0.986	positive regulation of biological process
GO:0019222	0.986	regulation of metabolic process
GO:0051716	0.983	cellular response to stimulus
GO:0048522	0.982	positive regulation of cellular process
GO:1904892	0.977	regulation of receptor signaling pathway via STAT
GO:0009967	0.973	positive regulation of signal transduction
GO:0009893	0.967	positive regulation of metabolic process
GO:0007165	0.951	signal transduction
GO:1904894	0.941	positive regulation of receptor signaling pathway via STAT
GO:0031323	0.939	regulation of cellular metabolic process
GO:0006950	0.932	response to stress
GO:0046425	0.923	regulation of receptor signaling pathway via JAK-STAT
GO:0006952	0.918	defense response
GO:0006955	0.831	immune response
GO:0031325	0.794	positive regulation of cellular metabolic process
GO:0043467	0.729	regulation of generation of precursor metabolites and energy
GO:0043457	0.721	regulation of cellular respiration
GO:0060255	0.704	regulation of macromolecule metabolic process
GO:0046427	0.622	positive regulation of receptor signaling pathway via JAK-STAT
GO:0010604	0.593	positive regulation of macromolecule metabolic process
GO:0006954	0.518	inflammatory response
GO:0007166	0.490	cell surface receptor signaling pathway
GO:0042221	0.470	response to chemical
GO:0010033	0.408	response to organic substance
GO:0051171	0.384	regulation of nitrogen compound metabolic process
GO:0080090	0.381	regulation of primary metabolic process
GO:0010468	0.364	regulation of gene expression
GO:0009605	0.359	response to external stimulus
GO:0034097	0.350	response to cytokine
GO:0070887	0.340	cellular response to chemical stimulus
GO:0043207	0.335	response to external biotic stimulus
GO:0051707	0.333	response to other organism
GO:0071345	0.320	cellular response to cytokine stimulus
GO:0051173	0.309	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005576	0.931	extracellular region
GO:0005622	0.693	intracellular anatomical structure
GO:0005737	0.664	cytoplasm
GO:0012505	0.372	endomembrane system
GO:0043226	0.315	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]