StarFunc result for job id Q08378

User Input

>input (1498 residues)
MDGASAEQDGLQEDRSHSGPSSLPEAPLKPPGPLVPPDQQDKVQCAEVNRASTEGESPDG
PGQGGLCQNGPTPPFPDPPSSLDPTTSPVGPDASPGVAGFHDNLRKSQGTSAEGSVRKEA
LQSLRLSLPMQETQLCSTDSPLPLEKEEQVRLQARKWLEEQLKQYRVKRQQERSSQPATK
TRLFSTLDPELMLNPENLPRASTLAMTKEYSFLRTSVPRGPKVGSLGLPAHPREKKTSKS
SKIRSLADYRTEDSNAGNSGGNVPAPDSTKGSLKQNRSSAASVVSEISLSPDTDDRLENT
SLAGDSVSEVDGNDSDSSSYSSASTRGTYGILSKTVGTQDTPYMVNGQEIPADTLGQFPS
IKDVLQAAAAEHQDQGQEVNGEVRSRRDSICSSVSLESSAAETQEEMLQVLKEKMRLEGQ
LEALSLEASQALKEKAELQAQLAALSTKLQAQVECSHSSQQRQDSLSSEVDTLKQSCWDL
ERAMTDLQNMLEAKNASLASSNNDLQVAEEQYQRLMAKVEDMQRSMLSKDNTVHDLRQQM
TALQSQLQQVQLERTTLTSKLKASQAEISSLQSVRQWYQQQLALAQEARVRLQGEMAHIQ
VGQMTQAGLLEHLKLENVSLSQQLTETQHRSMKEKGRIAAQLQGIEADMLDQEAAFMQIQ
EAKTMVEEDLQRRLEEFEGERERLQRMADSAASLEQQLEQVKLTLLQRDQQLEALQQEHL
DLMKQLTLTQEALQSREQSLDALQTHYDELQARLGELQGEAASREDTICLLQNEKIILEA
ALQAAKSGKEELDRGARRLEEGTEETSETLEKLREELAIKSGQVEHLQQETAALKKQMQK
IKEQFLQQKVMVEAYRRDATSKDQLISELKATRKRLDSELKELRQELMQVHGEKRTAEAE
LSRLHREVAQVRQHMADLEGHLQSAQKERDEMETHLQSLQFDKEQMVAVTEANEALKKQI
EELQQEARKAITEQKQKMRRLGSDLTSAQKEMKTKHKAYENAVGILSRRLQEALAAKEAA
DAELGQLRAQGGSSDSSLALHERIQALEAELQAVSHSKTLLEKELQEVIALTSQELEESR
EKVLELEDELQESRGFRKKIKRLEESNKKLALELEHEKGKLTGLGQSNAALREHNSILET
ALAKREADLVQLNLQVQAVLQRKEEEDRQMKHLVQALQASLEKEKEKVNSLKEQVAAAKV
EAGHNRRHFKAASLELSEVKKELQAKEHLVQKLQAEADDLQIREGKHSQEIAQFQAELAE
ARAQLQLLQKQLDEQLSKQPVGNQEMENLKWEVDQKEREIQSLKQQLDLTEQQGRKELEG
LQQLLQNVKSELEMAQEDLSMTQKDKFMLQAKVSELKNNMKTLLQQNQQLKLDLRRGAAK
TRKEPKGEASSSNPATPIKIPDCPVPASLLEELLRPPPAVSKEPLKNLNSCLQQLKQEMD
SLQRQMEEHALTVHESLSSWTPLEPATASPVPPGGHAGPRGDPQRHSQSRASKEGPGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55937	0.225	0.228	0.000	1487	0.814	0.820	P55937.pdb.gz	GOGA3_MOUSE Golgin subfamily A member 3 OS=Mus musculus OX=10090 GN=Golga3 PE=1 SV=3
2	AFDB:Q08378	1.000	1.000	0.000	1498	1.000	1.000	Q08378.pdb.gz	GOGA3_HUMAN Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3 PE=1 SV=2
3	AFDB:Q811D2	0.082	0.078	3.155E-9	1581	0.172	0.163	Q811D2.pdb.gz	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
4	AFDB:E7F5E1	0.060	0.065	6.248E-9	1367	0.139	0.152	E7F5E1.pdb.gz	CE162_DANRE Centrosomal protein of 162 kDa OS=Danio rerio OX=7955 GN=cep162 PE=2 SV=1
5	AFDB:Q96R06	0.086	0.103	6.648E-9	1193	0.132	0.165	Q96R06.pdb.gz	SPAG5_HUMAN Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2
6	AFDB:A1Z7Z9	0.069	0.087	1.688E-8	1134	0.103	0.137	A1Z7Z9.pdb.gz	CP131_DROME Centrosomal protein of 131 kDa OS=Drosophila melanogaster OX=7227 GN=dila PE=2 SV=2
7	AFDB:Q5TB80	0.053	0.054	1.688E-8	1403	0.134	0.143	Q5TB80.pdb.gz	CE162_HUMAN Centrosomal protein of 162 kDa OS=Homo sapiens OX=9606 GN=CEP162 PE=1 SV=2
8	AFDB:Q9UPS8	0.085	0.075	2.450E-8	1710	0.166	0.146	Q9UPS8.pdb.gz	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
9	AFDB:A0A0B4K7K9	0.070	0.049	3.343E-8	2238	0.184	0.123	A0A0B4K7K9.pdb.gz	A0A0B4K7K9_DROME Bruchpilot, isoform J OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
10	AFDB:Q9UPN4	0.083	0.110	3.785E-8	1083	0.122	0.169	Q9UPN4.pdb.gz	CP131_HUMAN Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3
11	PDB:2b5uA	0.066	0.173	1.023E-2	470	0.011	0.034	2b5uA.pdb.gz
12	PDB:7n6g3I	0.066	0.205	1.581E-2	401	0.040	0.150	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
13	PDB:3k29A	0.083	0.543	1.904E-2	162	0.017	0.154	3k29A.pdb.gz
14	PDB:5ew5A	0.074	0.207	3.331E-2	490	0.013	0.039	5ew5A.pdb.gz
15	PDB:7nsuD	0.072	0.232	3.331E-2	420	0.013	0.045	7nsuD.pdb.gz
16	PDB:5bw9g	0.074	0.534	3.771E-2	141	0.011	0.121	5bw9g.pdb.gz
17	PDB:7vvuV	0.054	0.371	4.544E-2	113	0.011	0.142	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
18	PDB:6z6oC	0.066	0.150	7.468E-2	548	0.017	0.046	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
19	PDB:3ajwA	0.042	0.329	8.456E-2	134	0.011	0.127	3ajwA.pdb.gz
20	PDB:6r1mB	0.039	0.114	1.084E-1	428	0.011	0.037	6r1mB.pdb.gz	Structure-Guided Enhancement of Selectivity of Chemical Probe Inhibitors Targeting Bacterial Seryl-tRNA Synthetase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P55937	0.0	2202	1487	0.811	0.817	GOGA3_MOUSE Golgin subfamily A member 3 OS=Mus musculus OX=10090 GN=Golga3 PE=1 SV=3
2	Q08378	0.0	2987	1498	1.000	1.000	GOGA3_HUMAN Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3 PE=1 SV=2
3	Q382P4	0.002	45.4	1299	0.072	0.083	Q382P4_TRYB2 IF rod domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0008 PE=4 SV=1
4	H2L0I2	0.005	44.3	2396	0.068	0.043	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
5	H2L0I4	0.006	43.9	2392	0.068	0.043	H2L0I4_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
6	H2L0I3	0.009	43.5	2323	0.068	0.044	H2L0I3_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
7	Q92351	0.025	41.6	1208	0.091	0.113	PCP1_SCHPO Spindle pole body protein pcp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pcp1 PE=1 SV=1
8	Q63644	0.046	40.8	1369	0.033	0.037	ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Rock1 PE=1 SV=1
9	Q6AW69	0.046	40.8	1297	0.081	0.094	CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus OX=10090 GN=Cgnl1 PE=1 SV=3
10	Q0VF96	0.058	40.4	1302	0.098	0.113	CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2
11	F4K498	0.11	39.3	628	0.035	0.084	F4K498_ARATH Prefoldin chaperone subunit family protein OS=Arabidopsis thaliana OX=3702 GN=At5g27330 PE=1 SV=1
12	Q13464	0.13	39.3	1354	0.033	0.037	ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1
13	Q6ZQ06	0.13	39.3	1403	0.053	0.056	CE162_MOUSE Centrosomal protein of 162 kDa OS=Mus musculus OX=10090 GN=Cep162 PE=1 SV=2
14	P70335	0.17	38.9	1354	0.033	0.037	ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Rock1 PE=1 SV=1
15	Q3UU96	0.18	38.9	1719	0.067	0.059	MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus OX=10090 GN=Cdc42bpa PE=1 SV=2
16	Q9NQX4	0.21	38.9	1742	0.031	0.026	MYO5C_HUMAN Unconventional myosin-Vc OS=Homo sapiens OX=9606 GN=MYO5C PE=1 SV=2
17	Q57WE8	0.26	38.5	4334	0.031	0.011	Q57WE8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.760 PE=4 SV=1
18	A0A8C0NIR0	0.33	38.1	1355	0.033	0.037	A0A8C0NIR0_CANLF Rho-associated protein kinase OS=Canis lupus familiaris OX=9615 GN=ROCK1 PE=1 SV=1
19	Q58G59	0.37	38.1	1363	0.027	0.030	KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio OX=7955 GN=kif7 PE=1 SV=1
20	O76447	0.44	37.7	1475	0.074	0.075	O76447_CAEEL HoloCentric chromosome binding Protein OS=Caenorhabditis elegans OX=6239 GN=hcp-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	0.47	22.2	Autophagy protein 16 (ATG16)
2	PF10473 CENP-F_leu_zip	2	19.9	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
3	PF13851 GAS	14	16.5	Growth-arrest specific micro-tubule binding
4	PF16515 HIP1_clath_bdg	3.2	19.5	Clathrin-binding domain of Huntingtin-interacting protein 1
5	PF14662 KASH_CCD	20	16.5	Coiled-coil region of CCDC155 or KASH
6	PF12325 TMF_TATA_bd	4.8	18.7	TATA element modulatory factor 1 TATA binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000204726

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258654	0.946	Conserved oligomeric Golgi complex subunit 3
2	9606.ENSP00000328551	0.945	Ras-related protein Rab-28
3	9606.ENSP00000355599	0.934	Translin-associated protein X
4	9606.ENSP00000355629	0.921	Conserved oligomeric Golgi complex subunit 2
5	9606.ENSP00000299886	0.902	Conserved oligomeric Golgi complex subunit 1
6	9606.ENSP00000305459	0.902	Conserved oligomeric Golgi complex subunit 8
7	9606.ENSP00000397441	0.902	Conserved oligomeric Golgi complex subunit 6
8	9606.ENSP00000297135	0.900	Conserved oligomeric Golgi complex subunit 5
9	9606.ENSP00000305442	0.900	Conserved oligomeric Golgi complex subunit 7
10	9606.ENSP00000315775	0.900	Conserved oligomeric Golgi complex subunit 4
11	9606.ENSP00000350378	0.856	Golgin subfamily A member 7
12	9606.ENSP00000355777	0.849	Golgi resident protein GCP60
13	9606.ENSP00000341765	0.829	Spermatogenesis-associated protein 16
14	9606.ENSP00000357484	0.817	Golgi-associated PDZ and coiled-coil motif-containing protein
15	9606.ENSP00000416097	0.778	Golgin subfamily A member 2
16	9606.ENSP00000349689	0.767	Palmitoyltransferase ZDHHC9
17	9606.ENSP00000244711	0.765	Male-enhanced antigen 1
18	9606.ENSP00000377275	0.743	Golgin subfamily B member 1
19	9606.ENSP00000265070	0.739	Golgi phosphoprotein 3
20	9606.ENSP00000267622	0.734	Thyroid receptor-interacting protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0045296	0.990	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071840	0.938	cellular component organization or biogenesis
GO:0016043	0.923	cellular component organization
GO:0065007	0.883	biological regulation
GO:0006996	0.822	organelle organization
GO:0050789	0.786	regulation of biological process
GO:0051179	0.783	localization
GO:0050794	0.694	regulation of cellular process
GO:0051234	0.618	establishment of localization
GO:0006810	0.504	transport
GO:0051641	0.485	cellular localization
GO:0007017	0.316	microtubule-based process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.996	Golgi membrane
GO:0005829	0.959	cytosol
GO:0070013	0.858	intracellular organelle lumen
GO:0031981	0.832	nuclear lumen
GO:0005654	0.690	nucleoplasm
GO:0043232	0.649	intracellular non-membrane-bounded organelle
GO:0031312	0.579	extrinsic component of organelle membrane
GO:0005730	0.466	nucleolus
GO:0005886	0.437	plasma membrane
GO:0090498	0.364	extrinsic component of Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]