StarFunc result for job id Q08379

User Input

>input (1002 residues)
MWPQPRLPPRPAMSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTT
SGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKT
FSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLKDLESRYQQLAVALDSSYVTNKQL
NITIEKLKQQNQEITDQLEEEKKECHQKQGALREQLQVHIQTIGILVSEKAELQTALAHT
QHAARQKEGESEDLASRLQYSRRRVGELERALSAVSTQQKKADRYNKELTKERDALRLEL
YKNTQSNEDLKQEKSELEEKLRVLVTEKAGMQLNLEELQKKLEMTELLLQQFSSRCEAPD
ANQQLQQAMEERAQLEAHLGQVMESVRQLQMERDKYAENLKGESAMWRQRMQQMSEQVHT
LREEKECSMSRVQELETSLAELRNQMAEPPPPEPPAGPSEVEQQLQAEAEHLRKELEGLA
GQLQAQVQDNEGLSRLNREQEERLLELERAAELWGEQAEARRQILETMQNDRTTISRALS
QNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVEL
KSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQGKAV
AEMARQELQETQERLEAATQQNQQLRAQLSLMAHPGEGDGLDREEEEDEEEEEEEAVAVP
QPMPSIPEDLESREAMVAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAHLLASAQKEPE
AAAPAPGTGGDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGET
DTIGEYIALYQSQRAVLKERHREKEEYISRLAQDKEEMKVKLLELQELVLRLVGDRNEWH
GRFLAAAQNPADEPTSGAPAPQELGAANQQGDLCEVSLAGSVEPAQGEAREGSPRDNPTA
QQIMQLLREMQNPRERPGLGSNPCIPFFYRADENDEVKITVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08379	1.000	1.000	0.000	1002	1.000	1.000	Q08379.pdb.gz	GOGA2_HUMAN Golgin subfamily A member 2 OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=3
2	AFDB:I3LSP4	0.193	0.193	2.543E-88	1005	0.750	0.748	I3LSP4.pdb.gz	I3LSP4_PIG Golgin subfamily A member 2 OS=Sus scrofa OX=9823 GN=GOLGA2 PE=1 SV=2
3	AFDB:Q921M4	0.277	0.278	1.047E-86	999	0.748	0.750	Q921M4.pdb.gz	GOGA2_MOUSE Golgin subfamily A member 2 OS=Mus musculus OX=10090 GN=Golga2 PE=1 SV=3
4	AFDB:A1IH00	0.238	0.234	3.913E-61	1028	0.507	0.494	A1IH00.pdb.gz	GOGA2_DANRE Golgin subfamily A member 2 OS=Danio rerio OX=7955 GN=golga2 PE=2 SV=1
5	AFDB:Q8IGK8	0.140	0.164	1.396E-7	840	0.220	0.262	Q8IGK8.pdb.gz	Q8IGK8_DROME RE72291p (Fragment) OS=Drosophila melanogaster OX=7227 GN=GM130 PE=2 SV=1
6	AFDB:Q8N9W4	0.096	0.105	2.744E-7	909	0.215	0.237	Q8N9W4.pdb.gz	GG6L2_HUMAN Golgin subfamily A member 6-like protein 2 OS=Homo sapiens OX=9606 GN=GOLGA6L2 PE=1 SV=3
7	AFDB:A6NEM1	0.088	0.185	5.702E-4	432	0.142	0.329	A6NEM1.pdb.gz	GG6L9_HUMAN Golgin subfamily A member 6-like protein 9 OS=Homo sapiens OX=9606 GN=GOLGA6L9 PE=1 SV=4
8	AFDB:O94488	0.092	0.085	1.121E-3	1115	0.152	0.136	O94488.pdb.gz	MBO1_SCHPO Microtubule organizer protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mbo1 PE=1 SV=1
9	AFDB:Q8S8D3	0.091	0.134	1.373E-3	643	0.063	0.098	Q8S8D3.pdb.gz	EREL2_ARATH PX domain-containing protein EREL2 OS=Arabidopsis thaliana OX=3702 GN=EREL2 PE=3 SV=1
10	AFDB:Q8N6V9	0.096	0.216	4.050E-3	391	0.078	0.199	Q8N6V9.pdb.gz	TEX9_HUMAN Testis-expressed protein 9 OS=Homo sapiens OX=9606 GN=TEX9 PE=1 SV=1
11	PDB:5fj9N	0.020	0.140	4.085	105	0.005	0.048	5fj9N.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
12	PDB:2w1tA	0.020	0.108	4.370	175	0.003	0.017	2w1tA.pdb.gz
13	PDB:6qw6S	0.026	0.143	5.003	126	0.013	0.103	6qw6S.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
14	PDB:7o4i1	0.042	0.066	6.128	522	0.012	0.023	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
15	PDB:7aavv	0.029	0.138	7.015	206	0.028	0.136	7aavv.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
16	PDB:1qr0A	0.020	0.078	7.506	228	0.010	0.044	1qr0A.pdb.gz	Crystal structure of the surfactin synthetase-activating enzyme sfp: a prototype of the 4'-phosphopantetheinyl transferase superfamily.
17	PDB:3apnA	0.017	0.029	8.592	563	0.009	0.016	3apnA.pdb.gz
18	PDB:4cfgA	0.061	0.284	8.592	164	0.032	0.195	4cfgA.pdb.gz
19	PDB:5mqfL	0.071	0.178	8.592	336	0.040	0.119	5mqfL.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
20	PDB:6n7pA	0.024	0.120	8.592	186	0.013	0.070	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WYC0	0.0	1571	796	0.794	1.000	A0A087WYC0_HUMAN Golgin A2 (Fragment) OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=2
2	A1IH00	0.0	845	1028	0.512	0.499	GOGA2_DANRE Golgin subfamily A member 2 OS=Danio rerio OX=7955 GN=golga2 PE=2 SV=1
3	B7ZC06	0.0	1996	997	0.995	1.000	B7ZC06_HUMAN Golgin A2 OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=4
4	F1RRA0	0.0	1216	872	0.659	0.757	F1RRA0_PIG Golgin subfamily A conserved domain-containing protein OS=Sus scrofa OX=9823 GN=GOLGA2 PE=1 SV=4
5	I3LSP4	0.0	1397	1005	0.746	0.743	I3LSP4_PIG Golgin subfamily A member 2 OS=Sus scrofa OX=9823 GN=GOLGA2 PE=1 SV=2
6	Q08379	0.0	2013	1002	1.000	1.000	GOGA2_HUMAN Golgin subfamily A member 2 OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=3
7	Q62839	0.0	1361	998	0.752	0.756	GOGA2_RAT Golgin subfamily A member 2 OS=Rattus norvegicus OX=10116 GN=Golga2 PE=1 SV=4
8	Q921M4	0.0	1345	999	0.745	0.747	GOGA2_MOUSE Golgin subfamily A member 2 OS=Mus musculus OX=10090 GN=Golga2 PE=1 SV=3
9	H0Y7B8	1.51e-142	427	241	0.214	0.888	H0Y7B8_HUMAN Golgin A2 (Fragment) OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=8
10	Q5PXD5	3.05e-135	406	194	0.194	1.000	Q5PXD5_HUMAN Golgi matrix protein GM130 (Fragment) OS=Homo sapiens OX=9606 GN=GOLGA2 PE=2 SV=1
11	Q9NYA3	7.90e-54	202	693	0.178	0.257	GOG6A_HUMAN Golgin subfamily A member 6A OS=Homo sapiens OX=9606 GN=GOLGA6A PE=1 SV=3
12	A6NCC3	1.86e-47	182	632	0.221	0.350	GOG8O_HUMAN Golgin subfamily A member 8O OS=Homo sapiens OX=9606 GN=GOLGA8O PE=1 SV=3
13	A8MQT2	2.24e-38	154	603	0.099	0.164	GOG8B_HUMAN Golgin subfamily A member 8B OS=Homo sapiens OX=9606 GN=GOLGA8B PE=2 SV=2
14	C9J1B5	3.90e-38	154	633	0.099	0.156	C9J1B5_HUMAN Golgin A8 family member B OS=Homo sapiens OX=9606 GN=GOLGA8B PE=4 SV=2
15	A7E2F4	6.06e-38	153	631	0.099	0.157	GOG8A_HUMAN Golgin subfamily A member 8A OS=Homo sapiens OX=9606 GN=GOLGA8A PE=2 SV=3
16	Q8N9W4	2.34e-36	150	909	0.091	0.100	GG6L2_HUMAN Golgin subfamily A member 6-like protein 2 OS=Homo sapiens OX=9606 GN=GOLGA6L2 PE=1 SV=3
17	Q0D2H9	1.74e-32	134	430	0.062	0.144	GOG8D_HUMAN Putative golgin subfamily A member 8D OS=Homo sapiens OX=9606 GN=GOLGA8DP PE=5 SV=1
18	Q08AF8	2.19e-32	133	430	0.062	0.144	GOG8F_HUMAN Putative golgin subfamily A member 8F/8G OS=Homo sapiens OX=9606 GN=GOLGA8F PE=5 SV=1
19	A6NEM1	8.15e-19	92.8	432	0.051	0.118	GG6L9_HUMAN Golgin subfamily A member 6-like protein 9 OS=Homo sapiens OX=9606 GN=GOLGA6L9 PE=1 SV=4
20	Q9HBQ8	1.82e-18	85.1	144	0.048	0.333	GGA2B_HUMAN Putative golgin subfamily A member 2B OS=Homo sapiens OX=9606 GN=GOLGA2P5 PE=5 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05103 DivIVA	44	15.5	DivIVA protein
2	PF19903 DUF6376	2.4	19.9	Family of unknown function (DUF6376)
3	PF19046 GM130_C	1.8e-25	99.7	GM130 C-terminal binding motif
4	PF15070 GOLGA2L5	5.4e-254	855.5	Putative golgin subfamily A member 2-like protein 5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416097

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313869	0.999	Golgi reassembly-stacking protein 1
2	9606.ENSP00000387286	0.998	Ras-related protein Rab-1A
3	9606.ENSP00000444850	0.998	General vesicular transport factor p115
4	9606.ENSP00000377275	0.996	Golgin subfamily B member 1
5	9606.ENSP00000234160	0.992	Golgi reassembly-stacking protein 2
6	9606.ENSP00000348573	0.975	A-kinase anchor protein 9
7	9606.ENSP00000294179	0.972	Syntaxin-5
8	9606.ENSP00000310226	0.972	Ras-related protein Rab-1B
9	9606.ENSP00000325748	0.961	Serine/threonine-protein kinase 25
10	9606.ENSP00000262646	0.942	Ras-related protein Rab-2A
11	9606.ENSP00000378699	0.940	Cyclin-dependent kinase 1
12	9606.ENSP00000390783	0.938	Sec1 family domain-containing protein 1
13	9606.ENSP00000259400	0.927	Syntaxin-17
14	9606.ENSP00000300093	0.925	Serine/threonine-protein kinase PLK1
15	9606.ENSP00000419782	0.921	Cyclin-dependent-like kinase 5
16	9606.ENSP00000258654	0.915	Conserved oligomeric Golgi complex subunit 3
17	9606.ENSP00000256442	0.910	G2/mitotic-specific cyclin-B1
18	9606.ENSP00000288207	0.905	G2/mitotic-specific cyclin-B2
19	9606.ENSP00000318486	0.905	Cyclin-dependent kinase 5 activator 1
20	9606.ENSP00000251047	0.903	Protein ERGIC-53

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019901	0.990	protein kinase binding
GO:0045296	0.630	cadherin binding
GO:0042802	0.612	identical protein binding
GO:0019905	0.610	syntaxin binding
GO:0008092	0.595	cytoskeletal protein binding
GO:0008017	0.541	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006996	0.987	organelle organization
GO:0007017	0.985	microtubule-based process
GO:0007049	0.983	cell cycle
GO:0065007	0.957	biological regulation
GO:0007051	0.950	spindle organization
GO:0048285	0.938	organelle fission
GO:0044085	0.936	cellular component biogenesis
GO:0050789	0.934	regulation of biological process
GO:0051225	0.932	spindle assembly
GO:0050794	0.910	regulation of cellular process
GO:0000280	0.884	nuclear division
GO:0048518	0.848	positive regulation of biological process
GO:0051179	0.835	localization
GO:0048522	0.826	positive regulation of cellular process
GO:0010256	0.810	endomembrane system organization
GO:0051234	0.761	establishment of localization
GO:1903047	0.753	mitotic cell cycle process
GO:0006810	0.722	transport
GO:0051641	0.618	cellular localization
GO:0098813	0.508	nuclear chromosome segregation
GO:0007030	0.502	Golgi organization
GO:0019222	0.449	regulation of metabolic process
GO:0008152	0.445	metabolic process
GO:0016192	0.428	vesicle-mediated transport
GO:0060255	0.399	regulation of macromolecule metabolic process
GO:0051649	0.377	establishment of localization in cell
GO:0048193	0.360	Golgi vesicle transport
GO:0046907	0.326	intracellular transport
GO:0080090	0.323	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.998	Golgi apparatus
GO:0031090	0.979	organelle membrane
GO:0098588	0.948	bounding membrane of organelle
GO:0031982	0.888	vesicle
GO:0000139	0.693	Golgi membrane
GO:0005829	0.559	cytosol
GO:0031984	0.534	organelle subcompartment
GO:0043232	0.514	intracellular non-membrane-bounded organelle
GO:0005801	0.463	cis-Golgi network
GO:0005795	0.454	Golgi stack
GO:0015630	0.432	microtubule cytoskeleton
GO:0031985	0.427	Golgi cisterna
GO:0000137	0.423	Golgi cis cisterna
GO:0005819	0.404	spindle
GO:0030134	0.393	COPII-coated ER to Golgi transport vesicle
GO:0072686	0.376	mitotic spindle
GO:0033116	0.366	endoplasmic reticulum-Golgi intermediate compartment membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]