StarFunc result for job id Q08426

User Input

>input (723 residues)
MAEYTRLHNALALIRLRNPPVNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEGKFSAG
ADIRGFSAPRTFGLTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQV
GLPEVTLGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPVEE
AIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAA
VQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANKWSTPSGASWKTASARPVSSV
GVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKMITSVLEKEASKMQQSGHPWSG
PKPRLTSSVKELGGVDLVIEAVFEEMSLKKQVFAELSAVCKPEAFLCTNTSALDVDEIAS
STDRPHLVIGTHFFSPAHVMKLLEVIPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFV
GNRMLNPYYNQAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLT
GPTLLPGTPARKRGNRRYCPIPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFL
SRYRKTHHIEPRTISQDEILERCLYSLINEAFRILGEGIAASPEHIDVVYLHGYGWPRHK
GGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPLKEWQSLAGSPS
SKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3zwaA	0.980	0.975	0.000	727	0.773	0.769	3zwaA.pdb.gz	The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
2	AFDB:P07896	0.969	0.970	0.000	722	0.773	0.774	P07896.pdb.gz	ECHP_RAT Peroxisomal bifunctional enzyme OS=Rattus norvegicus OX=10116 GN=Ehhadh PE=1 SV=2
3	AFDB:Q08426	1.000	1.000	0.000	723	1.000	1.000	Q08426.pdb.gz	ECHP_HUMAN Peroxisomal bifunctional enzyme OS=Homo sapiens OX=9606 GN=EHHADH PE=1 SV=3
4	AFDB:Q8W1L6	0.898	0.894	4.722E-61	726	0.328	0.326	Q8W1L6.pdb.gz	MFP_ORYSJ Peroxisomal fatty acid beta-oxidation multifunctional protein OS=Oryza sativa subsp. japonica OX=39947 GN=MFP PE=1 SV=2
5	AFDB:Q9ZPI6	0.893	0.896	6.714E-60	721	0.335	0.336	Q9ZPI6.pdb.gz	AIM1_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1 OS=Arabidopsis thaliana OX=3702 GN=AIM1 PE=1 SV=1
6	AFDB:Q9ZPI5	0.883	0.881	3.017E-59	725	0.329	0.328	Q9ZPI5.pdb.gz	MFP2_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 OS=Arabidopsis thaliana OX=3702 GN=MFP2 PE=1 SV=1
7	AFDB:Q39659	0.885	0.882	6.082E-59	725	0.318	0.317	Q39659.pdb.gz	MFPA_CUCSA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Cucumis sativus OX=3659 PE=1 SV=1
8	AFDB:P21177	0.855	0.849	1.585E-53	729	0.284	0.281	P21177.pdb.gz	FADB_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=fadB PE=1 SV=2
9	AFDB:P28793	0.847	0.856	1.299E-52	715	0.288	0.291	P28793.pdb.gz	FADB_PSEFR Fatty acid oxidation complex subunit alpha OS=Pseudomonas fragi OX=296 GN=fadB PE=1 SV=1
10	AFDB:P77399	0.827	0.837	2.494E-51	714	0.306	0.310	P77399.pdb.gz	FADJ_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=fadJ PE=1 SV=1
11	AFDB:Q64428	0.830	0.788	5.029E-51	763	0.282	0.267	Q64428.pdb.gz	ECHA_RAT Trifunctional enzyme subunit alpha, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hadha PE=1 SV=2
12	PDB:2wtbA	0.819	0.873	5.719E-51	676	0.300	0.321	2wtbA.pdb.gz
13	PDB:6ysvA	0.799	0.815	6.020E-50	708	0.308	0.315	6ysvA.pdb.gz
14	PDB:6tnmA	0.842	0.846	8.548E-50	719	0.288	0.289	6tnmA.pdb.gz	Insights into the stability and substrate specificity of the E. coli aerobic beta-oxidation trifunctional enzyme complex.
15	PDB:1wdlA	0.783	0.791	5.748E-47	715	0.288	0.291	1wdlA.pdb.gz	Structural basis for channelling mechanism of a fatty acid beta-oxidation multienzyme complex
16	PDB:6dv2G	0.830	0.827	5.748E-47	725	0.288	0.287	6dv2G.pdb.gz
17	PDB:4b3iA	0.797	0.788	1.281E-46	731	0.271	0.268	4b3iA.pdb.gz	Structure of Mycobacterial Beta-Oxidation Trifunctional Enzyme Reveals its Altered Assembly and Putative Substrate Channeling Pathway.
18	PDB:3mogC	0.465	0.701	1.137E-22	472	0.162	0.248	3mogC.pdb.gz
19	PDB:3rqsB	0.343	0.759	8.049E-19	316	0.129	0.294	3rqsB.pdb.gz
20	PDB:6hrdA	0.342	0.840	8.897E-19	285	0.124	0.316	6hrdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07896	0.0	1151	722	0.777	0.778	ECHP_RAT Peroxisomal bifunctional enzyme OS=Rattus norvegicus OX=10116 GN=Ehhadh PE=1 SV=2
2	Q08426	0.0	1489	723	1.000	1.000	ECHP_HUMAN Peroxisomal bifunctional enzyme OS=Homo sapiens OX=9606 GN=EHHADH PE=1 SV=3
3	Q9DBM2	0.0	1145	718	0.777	0.783	ECHP_MOUSE Peroxisomal bifunctional enzyme OS=Mus musculus OX=10090 GN=Ehhadh PE=1 SV=4
4	A0A060YYS8	9.54e-163	478	429	0.307	0.517	A0A060YYS8_ONCMY Enoyl-CoA hydratase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00049812001 PE=4 SV=1
5	Q39659	6.66e-129	401	725	0.336	0.335	MFPA_CUCSA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Cucumis sativus OX=3659 PE=1 SV=1
6	Q9ZPI6	6.41e-121	380	721	0.346	0.347	AIM1_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1 OS=Arabidopsis thaliana OX=3702 GN=AIM1 PE=1 SV=1
7	Q8W1L6	1.16e-116	369	726	0.339	0.337	MFP_ORYSJ Peroxisomal fatty acid beta-oxidation multifunctional protein OS=Oryza sativa subsp. japonica OX=39947 GN=MFP PE=1 SV=2
8	Q9ZPI5	2.55e-115	365	725	0.331	0.330	MFP2_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 OS=Arabidopsis thaliana OX=3702 GN=MFP2 PE=1 SV=1
9	E9KL44	1.35e-85	288	763	0.308	0.292	E9KL44_HUMAN enoyl-CoA hydratase OS=Homo sapiens OX=9606 PE=2 SV=1
10	P40939	1.35e-85	288	763	0.308	0.292	ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2
11	H0YFD6	1.85e-80	275	792	0.292	0.266	H0YFD6_HUMAN enoyl-CoA hydratase OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2
12	A7YT47	2.95e-80	273	761	0.290	0.276	A7YT47_DANRE enoyl-CoA hydratase OS=Danio rerio OX=7955 GN=hadha PE=1 SV=1
13	Q8IPE8	6.23e-80	272	744	0.320	0.310	Q8IPE8_DROME enoyl-CoA hydratase OS=Drosophila melanogaster OX=7227 GN=Mtpalpha PE=1 SV=1
14	P77399	7.56e-80	271	714	0.326	0.331	FADJ_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=fadJ PE=1 SV=1
15	Q9V397	1.13e-79	272	783	0.320	0.295	Q9V397_DROME enoyl-CoA hydratase OS=Drosophila melanogaster OX=7227 GN=Mtpalpha PE=1 SV=1
16	P28793	3.72e-79	269	715	0.278	0.281	FADB_PSEFR Fatty acid oxidation complex subunit alpha OS=Pseudomonas fragi OX=296 GN=fadB PE=1 SV=1
17	Q64428	5.01e-79	270	763	0.300	0.284	ECHA_RAT Trifunctional enzyme subunit alpha, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hadha PE=1 SV=2
18	Q586V7	1.36e-78	270	803	0.308	0.278	Q586V7_TRYB2 Enoyl-CoA hydratase/Enoyl-CoA isomerase/3-hydroxyacyl-CoA dehydrogenase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.415 PE=4 SV=1
19	P21177	2.09e-77	265	729	0.285	0.283	FADB_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=fadB PE=1 SV=2
20	Q8BMS1	3.27e-76	263	763	0.286	0.271	ECHA_MOUSE Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Hadha PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	92	13.8	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF00725 3HCDH	1.7e-34	129.6	3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
3	PF02737 3HCDH_N	1.2e-48	176.9	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
4	PF00378 ECH_1	1.7e-36	137.4	Enoyl-CoA hydratase/isomerase
5	PF16113 ECH_2	2.5e-20	84.9	Enoyl-CoA hydratase/isomerase
6	PF03446 NAD_binding_2	3.4	19.3	NAD binding domain of 6-phosphogluconate dehydrogenase
7	PF01343 Peptidase_S49	18	16.7	Peptidase family S49
8	PF02254 TrkA_N	42	15.8	TrkA-N domain
9	PF03721 UDPG_MGDP_dh_N	4.2	18.4	UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000231887

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293217	0.989	Peroxisomal acyl-coenzyme A oxidase 1
2	9606.ENSP00000333664	0.989	3-ketoacyl-CoA thiolase, peroxisomal
3	9606.ENSP00000420914	0.988	Peroxisomal multifunctional enzyme type 2
4	9606.ENSP00000369461	0.987	Enoyl-CoA delta isomerase 2, mitochondrial
5	9606.ENSP00000307697	0.986	Peroxisomal acyl-coenzyme A oxidase 2
6	9606.ENSP00000348775	0.983	Peroxisomal acyl-coenzyme A oxidase 3
7	9606.ENSP00000285093	0.982	3-ketoacyl-CoA thiolase, mitochondrial
8	9606.ENSP00000241052	0.975	Catalase
9	9606.ENSP00000355607	0.974	Glyceronephosphate O-acyltransferase
10	9606.ENSP00000265322	0.973	Peroxisomal trans-2-enoyl-CoA reductase
11	9606.ENSP00000325136	0.973	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
12	9606.ENSP00000438689	0.973	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
13	9606.ENSP00000360569	0.972	Non-specific lipid-transfer protein
14	9606.ENSP00000317721	0.971	Peroxisomal sarcosine oxidase
15	9606.ENSP00000233710	0.970	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
16	9606.ENSP00000242592	0.970	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
17	9606.ENSP00000356015	0.969	Acetyl-CoA acetyltransferase, cytosolic
18	9606.ENSP00000265838	0.968	Acetyl-CoA acetyltransferase, mitochondrial
19	9606.ENSP00000315013	0.968	Carnitine O-acetyltransferase
20	9606.ENSP00000371517	0.968	Alpha-methylacyl-CoA racemase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0004300	0.999	enoyl-CoA hydratase activity
GO:0003857	0.999	3-hydroxyacyl-CoA dehydrogenase activity
GO:0016860	0.786	intramolecular oxidoreductase activity
GO:0004165	0.464	delta(3)-delta(2)-enoyl-CoA isomerase activity
GO:0042802	0.440	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006635	0.997	fatty acid beta-oxidation
GO:0006807	0.327	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.999	intracellular organelle lumen
GO:0005829	0.998	cytosol
GO:0005777	0.998	peroxisome
GO:0005739	0.794	mitochondrion
GO:0005782	0.705	peroxisomal matrix
GO:0031981	0.393	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22432	0.999	a (3S)-3-hydroxyacyl-CoA + NAD(+) = a 3-oxoacyl-CoA + H(+) + NADH
RHEA:16105	0.999	a (3S)-3-hydroxyacyl-CoA = a (2E)-enoyl-CoA + H2O
EC:4.2.1.17	0.999	enoyl-CoA hydratase.
EC:1.1.1.35	0.999	3-hydroxyacyl-CoA dehydrogenase.
EC:5.3.-.-	0.786	Intramolecular oxidoreductases.
RHEA:45900	0.464	a (3Z)-enoyl-CoA = a 4-saturated (2E)-enoyl-CoA
EC:5.3.3.8	0.464	Delta(3)-Delta(2)-enoyl-CoA isomerase.

[back to server]