StarFunc result for job id Q08462

User Input

>input (1091 residues)
MWQEAMRRRRYLRDRSEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGSCLA
LLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAM
GYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSAT
PGGKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQ
ERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFT
RLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVK
MGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG
VPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPR
HTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTL
RTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAF
KYYVTCACLIFFCIFIVQILVLPKTSVLGISFGAAFLLLAFILFVCFAGQLLQCSKKASP
LLMWLLKSSGIIANRPWPRISLTIITTAIILMMAVFNMFFLSDSEETIPPTANTTNTSFS
ASNNQVAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHT
HAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKK
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFY
TESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHS
QEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDI
WGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEM
SRSLSQSNVAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LQT1	0.866	0.859	0.000	1100	0.533	0.529	F1LQT1.pdb.gz	F1LQT1_RAT Adenylate cyclase type 7 OS=Rattus norvegicus OX=10116 GN=Adcy7 PE=3 SV=2
2	AFDB:P51828	0.884	0.893	0.000	1080	0.542	0.547	P51828.pdb.gz	ADCY7_HUMAN Adenylate cyclase type 7 OS=Homo sapiens OX=9606 GN=ADCY7 PE=1 SV=1
3	AFDB:Q08462	1.000	1.000	0.000	1091	1.000	1.000	Q08462.pdb.gz	ADCY2_HUMAN Adenylate cyclase type 2 OS=Homo sapiens OX=9606 GN=ADCY2 PE=1 SV=5
4	AFDB:Q29450	0.883	0.893	0.000	1078	0.525	0.532	Q29450.pdb.gz	ADCY7_BOVIN Adenylate cyclase type 7 OS=Bos taurus OX=9913 GN=ADCY7 PE=2 SV=1
5	AFDB:Q8NFM4	0.903	0.914	0.000	1077	0.553	0.560	Q8NFM4.pdb.gz	ADCY4_HUMAN Adenylate cyclase type 4 OS=Homo sapiens OX=9606 GN=ADCY4 PE=1 SV=1
6	AFDB:P84309	0.796	0.692	1.528E-87	1262	0.376	0.325	P84309.pdb.gz	ADCY5_MOUSE Adenylate cyclase type 5 OS=Mus musculus OX=10090 GN=Adcy5 PE=1 SV=2
7	AFDB:P30803	0.789	0.686	3.788E-87	1265	0.377	0.325	P30803.pdb.gz	ADCY5_CANLF Adenylate cyclase type 5 OS=Canis lupus familiaris OX=9615 GN=ADCY5 PE=1 SV=2
8	AFDB:D2CFN3	0.783	0.723	4.372E-87	1186	0.368	0.338	D2CFN3.pdb.gz	D2CFN3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:dkey-178j17.2 PE=2 SV=1
9	AFDB:E9QDH0	0.805	0.756	1.748E-86	1165	0.372	0.348	E9QDH0.pdb.gz
10	AFDB:O43306	0.787	0.738	2.957E-86	1168	0.379	0.354	O43306.pdb.gz	ADCY6_HUMAN Adenylate cyclase type 6 OS=Homo sapiens OX=9606 GN=ADCY6 PE=1 SV=2
11	PDB:7yziA	0.191	0.495	1.025E-15	378	0.085	0.246	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
12	PDB:7d9rA	0.194	0.398	1.874E-13	502	0.068	0.147	7d9rA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
13	PDB:7d9tA	0.181	0.372	5.626E-13	512	0.068	0.145	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
14	PDB:6jt0A	0.178	0.349	1.463E-12	542	0.067	0.135	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
15	PDB:6jt0B	0.188	0.337	5.068E-12	576	0.065	0.123	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
16	PDB:1y11A	0.144	0.386	4.851E-7	364	0.054	0.162	1y11A.pdb.gz
17	PDB:4h54A	0.097	0.343	2.494E-2	274	0.033	0.131	4h54A.pdb.gz	Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
18	PDB:3breB	0.111	0.305	7.853E-2	328	0.023	0.076	3breB.pdb.gz	Phosphorylation-independent regulation of the diguanylate cyclase WspR.
19	PDB:2xmaE	0.072	0.326	1.393E-1	141	0.015	0.113	2xmaE.pdb.gz	DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
20	PDB:6muuA	0.079	0.107	1.533E-1	780	0.015	0.021	6muuA.pdb.gz	Type III-A CRISPR-Cas Csm Complexes: Assembly, Periodic RNA Cleavage, DNase Activity Regulation, and Autoimmunity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A384P5Q5	706	1261	0.369	0.320	A0A384P5Q5_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 PE=2 SV=1
2	B3KWA8	671	919	0.356	0.422	B3KWA8_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=1
3	B7UCF8	654	1225	0.357	0.318	B7UCF8_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:ch211-220f13.4 PE=2 SV=1
4	C9JRT8	621	820	0.330	0.439	C9JRT8_HUMAN Adenylate cyclase 5 OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=2
5	D1MIA3	593	1114	0.356	0.348	D1MIA3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=ADCY1b PE=2 SV=1
6	D2CFN3	694	1186	0.377	0.347	D2CFN3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:dkey-178j17.2 PE=2 SV=1
7	D4A3N4	618	1119	0.354	0.345	D4A3N4_RAT Adenylate cyclase type 1 OS=Rattus norvegicus OX=10116 GN=Adcy1 PE=1 SV=3
8	F1LQT1	1096	1100	0.537	0.533	F1LQT1_RAT Adenylate cyclase type 7 OS=Rattus norvegicus OX=10116 GN=Adcy7 PE=3 SV=2
9	G0TC75	1964	982	0.861	0.956	G0TC75_BOVIN adenylate cyclase OS=Bos taurus OX=9913 GN=ADCY2 PE=2 SV=1
10	O43306	688	1168	0.359	0.336	ADCY6_HUMAN Adenylate cyclase type 6 OS=Homo sapiens OX=9606 GN=ADCY6 PE=1 SV=2
11	O60266	599	1144	0.350	0.334	ADCY3_HUMAN Adenylate cyclase type 3 OS=Homo sapiens OX=9606 GN=ADCY3 PE=1 SV=3
12	O88444	617	1118	0.356	0.347	ADCY1_MOUSE Adenylate cyclase type 1 OS=Mus musculus OX=10090 GN=Adcy1 PE=1 SV=2
13	O95622	706	1261	0.369	0.320	ADCY5_HUMAN Adenylate cyclase type 5 OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=3
14	P19754	623	1134	0.346	0.333	ADCY1_BOVIN Adenylate cyclase type 1 OS=Bos taurus OX=9913 GN=ADCY1 PE=1 SV=1
15	P21932	594	1144	0.339	0.323	ADCY3_RAT Adenylate cyclase type 3 OS=Rattus norvegicus OX=10116 GN=Adcy3 PE=1 SV=1
16	P26769	2137	1090	0.937	0.938	ADCY2_RAT Adenylate cyclase type 2 OS=Rattus norvegicus OX=10116 GN=Adcy2 PE=1 SV=1
17	P26770	1170	1064	0.558	0.572	ADCY4_RAT Adenylate cyclase type 4 OS=Rattus norvegicus OX=10116 GN=Adcy4 PE=1 SV=1
18	P30803	710	1265	0.370	0.319	ADCY5_CANLF Adenylate cyclase type 5 OS=Canis lupus familiaris OX=9615 GN=ADCY5 PE=1 SV=2
19	P40145	647	1251	0.350	0.305	ADCY8_HUMAN Adenylate cyclase type 8 OS=Homo sapiens OX=9606 GN=ADCY8 PE=1 SV=1
20	P40146	646	1248	0.351	0.307	ADCY8_RAT Adenylate cyclase type 8 OS=Rattus norvegicus OX=10116 GN=Adcy8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16214 AC_N	3.3e-26	104.0	Adenylyl cyclase N-terminal extracellular and transmembrane region
2	PF06327 Adcy_cons_dom	1.9e-34	129.6	Adenylate cyclase, conserved domain
3	PF00211 Guanylate_cyc	7.8e-121	412.0	Adenylate and Guanylate cyclase catalytic domain
4	PF07701 HNOBA	1.2e+02	13.5	Heme NO binding associated

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342952

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360141	0.985	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
2	9606.ENSP00000419361	0.972	Adenylate cyclase type 5
3	9606.ENSP00000334051	0.966	Guanine nucleotide-binding protein G(olf) subunit alpha
4	9606.ENSP00000262494	0.957	Guanine nucleotide-binding protein G(o) subunit alpha
5	9606.ENSP00000294016	0.955	Adenylate cyclase type 9
6	9606.ENSP00000343027	0.952	Guanine nucleotide-binding protein G(i) subunit alpha-1
7	9606.ENSP00000312999	0.948	Guanine nucleotide-binding protein G(i) subunit alpha-2
8	9606.ENSP00000297323	0.946	Adenylate cyclase type 1
9	9606.ENSP00000358867	0.945	Guanine nucleotide-binding protein G(k) subunit alpha
10	9606.ENSP00000286355	0.938	Adenylate cyclase type 8
11	9606.ENSP00000311405	0.936	Adenylate cyclase type 6
12	9606.ENSP00000260600	0.933	Adenylate cyclase type 3
13	9606.ENSP00000478892	0.928	Guanine nucleotide-binding protein G(z) subunit alpha
14	9606.ENSP00000306124	0.906	Protein kinase C epsilon type
15	9606.ENSP00000315011	0.904	Endothelin-1 receptor
16	9606.ENSP00000378187	0.903	Adenylate cyclase type 7
17	9606.ENSP00000312126	0.902	Adenylate cyclase type 4
18	9606.ENSP00000368683	0.901	Endothelin-1
19	9606.ENSP00000366488	0.848	cAMP-dependent protein kinase catalytic subunit gamma
20	9606.ENSP00000376475	0.838	cAMP-dependent protein kinase type I-alpha regulatory subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004016	1.000	adenylate cyclase activity
GO:0005515	0.989	protein binding
GO:0019899	0.389	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0050896	0.971	response to stimulus
GO:0050789	0.969	regulation of biological process
GO:0050794	0.964	regulation of cellular process
GO:0071704	0.947	organic substance metabolic process
GO:0044238	0.943	primary metabolic process
GO:0044237	0.943	cellular metabolic process
GO:0006796	0.933	phosphate-containing compound metabolic process
GO:0006807	0.932	nitrogen compound metabolic process
GO:0042221	0.930	response to chemical
GO:1901564	0.924	organonitrogen compound metabolic process
GO:0007165	0.906	signal transduction
GO:0009150	0.865	purine ribonucleotide metabolic process
GO:0052652	0.845	cyclic purine nucleotide metabolic process
GO:0046058	0.827	cAMP metabolic process
GO:0009190	0.827	cyclic nucleotide biosynthetic process
GO:0009152	0.805	purine ribonucleotide biosynthetic process
GO:0007186	0.783	G protein-coupled receptor signaling pathway
GO:0010033	0.640	response to organic substance
GO:0065009	0.402	regulation of molecular function
GO:0070887	0.381	cellular response to chemical stimulus
GO:0006171	0.379	cAMP biosynthetic process
GO:1901700	0.342	response to oxygen-containing compound
GO:0050790	0.336	regulation of catalytic activity
GO:0071310	0.324	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.904	intracellular anatomical structure
GO:0005737	0.759	cytoplasm
GO:0043226	0.711	organelle
GO:0043229	0.612	intracellular organelle
GO:0043227	0.519	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15389	1.000	ATP = 3',5'-cyclic AMP + diphosphate
EC:4.6.1.1	1.000	adenylate cyclase.

[back to server]