StarFunc result for job id Q08493

User Input

>input (712 residues)
MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERD
LSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQSSPGLGRIMQAPVPHSQRRESF
LYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQCLGA
AKQGPVGNPSSSNQLPPAEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMASNKFKRI
LNRELTHLSETSRSGNQVSEYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSA
SLSSATVPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAIIFSIFQERDLL
KTFQIPADTLATYLLMLEGHYHANVAYHNSLHAADVAQSTHVLLATPALEAVFTDLEILA
ALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQAENCDIFQNL
SAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQN
LVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGF
IDYIAHPLWETWADLVHPDAQDLLDTLEDNREWYQSKIPRSPSDLTNPERDGPDRFQFEL
TLEEAEEEDEEEEEEGEETALAKEALELPDTELLSPEAGPDPGDLPLDNQRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08493	1.000	1.000	1.311E-85	712	1.000	1.000	Q08493.pdb.gz	PDE4C_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4C OS=Homo sapiens OX=9606 GN=PDE4C PE=1 SV=2
2	AFDB:A0A140VJR0	0.688	0.608	1.210E-57	809	0.673	0.592	A0A140VJR0.pdb.gz	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
3	AFDB:Q3UEI1	0.505	0.524	6.114E-56	686	0.690	0.716	Q3UEI1.pdb.gz	PDE4C_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4C OS=Mus musculus OX=10090 GN=Pde4c PE=1 SV=1
4	AFDB:Q9W4S9	0.694	0.507	3.162E-50	983	0.541	0.392	Q9W4S9.pdb.gz	PDE4C_DROME cAMP-specific 3',5'-cyclic phosphodiesterase, isoforms N/G OS=Drosophila melanogaster OX=7227 GN=dnc PE=3 SV=2
5	AFDB:Q2V4U0	0.556	0.587	3.597E-42	673	0.449	0.475	Q2V4U0.pdb.gz	Q2V4U0_CAEEL Phosphodiesterase OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=1 SV=1
6	AFDB:O18696	0.403	0.431	1.581E-22	664	0.246	0.264	O18696.pdb.gz	PDE1_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-1 OS=Caenorhabditis elegans OX=6239 GN=pde-1 PE=1 SV=2
7	AFDB:E9Q4S1	0.470	0.390	6.884E-22	865	0.202	0.166	E9Q4S1.pdb.gz	PDE8B_MOUSE High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B OS=Mus musculus OX=10090 GN=Pde8b PE=1 SV=1
8	AFDB:O60658	0.463	0.401	2.443E-21	829	0.198	0.170	O60658.pdb.gz	PDE8A_HUMAN High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Homo sapiens OX=9606 GN=PDE8A PE=1 SV=2
9	AFDB:O88502	0.425	0.369	2.877E-21	823	0.180	0.156	O88502.pdb.gz	PDE8A_MOUSE High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Mus musculus OX=10090 GN=Pde8a PE=1 SV=1
10	AFDB:B7YZV4	0.451	0.388	3.676E-21	834	0.232	0.198	B7YZV4.pdb.gz	PDE1_DROME Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1 OS=Drosophila melanogaster OX=7227 GN=Pde1c PE=1 SV=1
11	PDB:4y86B	0.413	0.886	2.467E-18	326	0.132	0.288	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
12	PDB:3bjcA	0.381	0.837	3.227E-14	311	0.126	0.289	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
13	PDB:7jsnA	0.405	0.353	7.015E-14	820	0.143	0.124	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
14	PDB:6mzbB	0.409	0.362	1.723E-13	807	0.147	0.130	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
15	PDB:7np7D1	0.119	0.154	5.351E-1	485	0.080	0.118	7np7D1.pdb.gz
16	PDB:4nq0A	0.113	0.239	5.807E-1	254	0.060	0.169	4nq0A.pdb.gz
17	PDB:7s1xB	0.102	0.090	6.049E-1	871	0.063	0.052	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
18	PDB:7pksh	0.085	0.073	1.072	887	0.100	0.080	7pksh.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
19	PDB:7p9uB	0.105	0.142	1.116	455	0.073	0.114	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
20	PDB:6zfzA	0.066	0.088	1.163	446	0.060	0.096	6zfzA.pdb.gz	From structure to clinic: Design of a muscarinic M1 receptor agonist with potential to treatment of Alzheimer's disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A140VJR0	976	809	0.671	0.591	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
2	A0A1B0GW84	950	699	0.646	0.658	A0A1B0GW84_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=1 SV=1
3	A0A1U7QDZ1	976	804	0.678	0.601	A0A1U7QDZ1_MESAU Phosphodiesterase OS=Mesocricetus auratus OX=10036 GN=Pde4d PE=3 SV=1
4	B1AWC8	858	659	0.615	0.665	B1AWC8_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
5	B1AWC9	858	736	0.615	0.595	B1AWC9_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
6	B1AWD0	741	564	0.521	0.658	B1AWD0_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
7	B1AWD1	580	402	0.399	0.706	B1AWD1_MOUSE 3',5'-cyclic-AMP phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
8	O89084	880	844	0.657	0.555	PDE4A_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Mus musculus OX=10090 GN=Pde4a PE=1 SV=2
9	P12252	725	1070	0.524	0.349	PDE4B_DROME cAMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=dnc PE=1 SV=4
10	P14270	977	803	0.678	0.601	PDE4D_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Rattus norvegicus OX=10116 GN=Pde4d PE=1 SV=4
11	P14644	895	536	0.617	0.819	PDE4C_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4C (Fragment) OS=Rattus norvegicus OX=10116 GN=Pde4c PE=2 SV=2
12	P14646	859	736	0.617	0.596	PDE4B_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4B OS=Rattus norvegicus OX=10116 GN=Pde4b PE=1 SV=4
13	P27815	885	886	0.662	0.532	PDE4A_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Homo sapiens OX=9606 GN=PDE4A PE=1 SV=3
14	P54748	857	844	0.654	0.552	PDE4A_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Rattus norvegicus OX=10116 GN=Pde4a PE=1 SV=1
15	Q01063	947	747	0.645	0.614	PDE4D_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Mus musculus OX=10090 GN=Pde4d PE=1 SV=2
16	Q07343	859	736	0.612	0.592	PDE4B_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4B OS=Homo sapiens OX=9606 GN=PDE4B PE=1 SV=1
17	Q08493	1468	712	1.000	1.000	PDE4C_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4C OS=Homo sapiens OX=9606 GN=PDE4C PE=1 SV=2
18	Q08499	976	809	0.671	0.591	PDE4D_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Homo sapiens OX=9606 GN=PDE4D PE=1 SV=2
19	Q22000	603	674	0.433	0.457	PDE4_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-4 OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=2 SV=2
20	Q2V4U0	602	673	0.444	0.470	Q2V4U0_CAEEL Phosphodiesterase OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20242 Emfourin	1.4e+02	14.3	Emfourin
2	PF18100 PDE4_UCR	9.1e-48	173.3	Phosphodiesterase 4 upstream conserved regions (UCR)
3	PF00233 PDEase_I	1.6e-85	298.2	3'5'-cyclic nucleotide phosphodiesterase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347689

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371230	0.908	GTP:AMP phosphotransferase AK3, mitochondrial
2	9606.ENSP00000286621	0.906	Adenosine kinase
3	9606.ENSP00000485525	0.906	Adenylosuccinate lyase
4	9606.ENSP00000286648	0.902	Deoxycytidine kinase
5	9606.ENSP00000367615	0.900	Adenine phosphoribosyltransferase
6	9606.ENSP00000294016	0.861	Adenylate cyclase type 9
7	9606.ENSP00000419361	0.858	Adenylate cyclase type 5
8	9606.ENSP00000311405	0.855	Adenylate cyclase type 6
9	9606.ENSP00000286355	0.812	Adenylate cyclase type 8
10	9606.ENSP00000297323	0.804	Adenylate cyclase type 1
11	9606.ENSP00000356825	0.804	Adenylate cyclase type 10
12	9606.ENSP00000260600	0.801	Adenylate cyclase type 3
13	9606.ENSP00000312126	0.790	Adenylate cyclase type 4
14	9606.ENSP00000309591	0.767	cAMP-dependent protein kinase catalytic subunit alpha
15	9606.ENSP00000342952	0.767	Adenylate cyclase type 2
16	9606.ENSP00000359719	0.763	cAMP-dependent protein kinase catalytic subunit beta
17	9606.ENSP00000378187	0.760	Adenylate cyclase type 7
18	9606.ENSP00000366488	0.755	cAMP-dependent protein kinase catalytic subunit gamma
19	9606.ENSP00000387123	0.732	Alpha-aminoadipic semialdehyde dehydrogenase
20	9606.ENSP00000354238	0.682	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004115	0.999	3',5'-cyclic-AMP phosphodiesterase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050896	0.985	response to stimulus
GO:0050794	0.978	regulation of cellular process
GO:0051716	0.962	cellular response to stimulus
GO:0042221	0.926	response to chemical
GO:0070887	0.844	cellular response to chemical stimulus
GO:0010646	0.755	regulation of cell communication
GO:0071704	0.734	organic substance metabolic process
GO:0044238	0.713	primary metabolic process
GO:0044237	0.696	cellular metabolic process
GO:0006807	0.689	nitrogen compound metabolic process
GO:0032501	0.615	multicellular organismal process
GO:0023051	0.578	regulation of signaling
GO:0007165	0.491	signal transduction
GO:0009117	0.490	nucleotide metabolic process
GO:1901564	0.437	organonitrogen compound metabolic process
GO:0006163	0.400	purine nucleotide metabolic process
GO:0009150	0.384	purine ribonucleotide metabolic process
GO:0010033	0.306	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.977	membrane
GO:0043226	0.969	organelle
GO:0043227	0.957	membrane-bounded organelle
GO:0071944	0.941	cell periphery
GO:0005576	0.938	extracellular region
GO:0043229	0.875	intracellular organelle
GO:0005615	0.783	extracellular space
GO:0043232	0.719	intracellular non-membrane-bounded organelle
GO:0043231	0.718	intracellular membrane-bounded organelle
GO:0032991	0.452	protein-containing complex
GO:0005815	0.448	microtubule organizing center
GO:0005886	0.405	plasma membrane
GO:0005813	0.372	centrosome
GO:0031982	0.370	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:25277	0.999	3',5'-cyclic AMP + H2O = AMP + H(+)
EC:3.1.4.53	0.999	3',5'-cyclic-AMP phosphodiesterase.

[back to server]