StarFunc result for job id Q08495

User Input

>input (405 residues)
MERLQKQPLTSPGSVSPSRDSSVPGSPSSIVAKMDNQVLGYKDLAAIPKDKAILDIERPD
LMIYEPHFTYSLLEHVELPRSRERSLSPKSTSPPPSPEVWADSRSPGIISQASAPRTTGT
PRTSLPHFHHPETSRPDSNIYKKPPIYKQRESVGGSPQTKHLIEDLIIESSKFPAAQPPD
PNQPAKIETDYWPCPPSLAVVETEWRKRKASRRGAEEEEEEEDDDSGEEMKALRERQREE
LSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSLHQGTSKSSSLPAYGRTTLSR
LQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVLEQKIYPYEMLVVTNKGRTKLPP
GVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKASLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08495	1.000	1.000	3.053E-61	405	1.000	1.000	Q08495.pdb.gz	DEMA_HUMAN Dematin OS=Homo sapiens OX=9606 GN=DMTN PE=1 SV=3
2	AFDB:A0A0G2JW01	0.200	0.192	1.298E-24	427	0.452	0.429	A0A0G2JW01.pdb.gz	A0A0G2JW01_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=2
3	AFDB:Q8K4G5	0.204	0.103	1.971E-22	861	0.477	0.224	Q8K4G5.pdb.gz	ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus OX=10090 GN=Ablim1 PE=1 SV=1
4	AFDB:O14639	0.199	0.106	2.526E-22	778	0.462	0.240	O14639.pdb.gz	ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3
5	AFDB:A0A0B4LGY0	0.167	0.094	5.465E-10	772	0.272	0.142	A0A0B4LGY0.pdb.gz	A0A0B4LGY0_DROME Uncoordinated 115a, isoform H OS=Drosophila melanogaster OX=7227 GN=Unc-115a PE=4 SV=1
6	AFDB:Q10L71	0.158	0.069	9.174E-5	966	0.128	0.054	Q10L71.pdb.gz	VLN2_ORYSJ Villin-2 OS=Oryza sativa subsp. japonica OX=39947 GN=VLN2 PE=2 SV=1
7	AFDB:O65570	0.162	0.070	2.633E-4	974	0.081	0.034	O65570.pdb.gz	VILI4_ARATH Villin-4 OS=Arabidopsis thaliana OX=3702 GN=VLN4 PE=1 SV=1
8	AFDB:O14210	0.068	0.087	6.988E-2	295	0.116	0.159	O14210.pdb.gz	IES2_SCHPO INO80 complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ies2 PE=1 SV=1
9	AFDB:Q0JNI9	0.069	0.046	1.148E-1	637	0.163	0.104	Q0JNI9.pdb.gz	PIL15_ORYSJ Transcription factor PHYTOCHROME INTERACTING FACTOR-LIKE 15 OS=Oryza sativa subsp. japonica OX=39947 GN=PIL15 PE=1 SV=2
10	AFDB:Q9CAC4	0.077	0.050	2.909E-1	749	0.165	0.089	Q9CAC4.pdb.gz	MYOB2_ARATH Myosin-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=MYOB2 PE=1 SV=1
11	PDB:7rroi	0.077	0.122	3.337	235	0.079	0.136	7rroi.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:7ungi	0.078	0.119	3.337	250	0.104	0.168	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
13	PDB:7mq9SI	0.054	0.033	5.832	844	0.067	0.032	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7w59R	0.075	0.095	7.024	280	0.062	0.089	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
15	PDB:6ke6RC	0.073	0.085	7.952	278	0.057	0.083	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
16	PDB:7pu7A	0.096	0.042	7.952	1070	0.027	0.010	7pu7A.pdb.gz	DNA-Dependent Binding of Nargenicin to DnaE1 Inhibits Replication in Mycobacterium tuberculosis.
17	PDB:7aavv	0.052	0.099	9.577	206	0.059	0.117	7aavv.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08495	0.0	820	405	1.000	1.000	DEMA_HUMAN Dematin OS=Homo sapiens OX=9606 GN=DMTN PE=1 SV=3
2	Q9WV69	0.0	791	405	0.960	0.960	DEMA_MOUSE Dematin OS=Mus musculus OX=10090 GN=Dmtn PE=1 SV=1
3	Q3KR72	1.60e-94	291	427	0.479	0.454	Q3KR72_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=2 SV=1
4	A0A0G2JW01	4.68e-94	291	455	0.479	0.426	A0A0G2JW01_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=2
5	A0A8I6GGU3	2.54e-92	293	669	0.484	0.293	A0A8I6GGU3_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=1
6	A0A8I6G9J9	7.17e-92	292	666	0.479	0.291	A0A8I6G9J9_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=1
7	O14639	1.23e-90	291	778	0.486	0.253	ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3
8	A0A8I6A592	2.19e-88	285	745	0.494	0.268	A0A8I6A592_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=1
9	A0A8I6ABC6	2.52e-88	283	702	0.489	0.282	A0A8I6ABC6_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=1
10	A0A8I5ZVV8	1.42e-87	283	779	0.489	0.254	A0A8I5ZVV8_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=1
11	Q8K4G5	2.15e-63	220	861	0.343	0.161	ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus OX=10090 GN=Ablim1 PE=1 SV=1
12	A0A8I5Y6A1	8.99e-63	218	863	0.338	0.159	A0A8I5Y6A1_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=1
13	A0A8I5Y740	4.88e-62	213	683	0.422	0.250	A0A8I5Y740_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=1
14	F1LWK7	2.03e-56	197	603	0.360	0.242	F1LWK7_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=4
15	Q69ZX8	1.27e-51	185	682	0.407	0.242	ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus OX=10090 GN=Ablim3 PE=1 SV=2
16	O94929	7.59e-51	183	683	0.405	0.240	ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens OX=9606 GN=ABLIM3 PE=1 SV=3
17	Q6H8Q1	6.98e-23	103	611	0.143	0.095	ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens OX=9606 GN=ABLIM2 PE=1 SV=2
18	Q8BL65	5.28e-22	100	612	0.116	0.077	ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus OX=10090 GN=Ablim2 PE=1 SV=1
19	A0A0B4LGY0	1.32e-11	68.6	772	0.077	0.040	A0A0B4LGY0_DROME Uncoordinated 115a, isoform H OS=Drosophila melanogaster OX=7227 GN=Unc-115a PE=4 SV=1
20	E1JIH1	1.41e-11	68.6	813	0.077	0.038	E1JIH1_DROME Uncoordinated 115a, isoform J OS=Drosophila melanogaster OX=7227 GN=Unc-115a PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16182 AbLIM_anchor	1.3e-100	349.6	Putative adherens-junction anchoring region of AbLIM
2	PF02209 VHP	3e-11	54.4	Villin headpiece domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427866

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264436	0.952	Beta-adducin
2	9606.ENSP00000348381	0.879	Gamma-adducin
3	9606.ENSP00000264758	0.876	Alpha-adducin
4	9606.ENSP00000300215	0.844	Erythrocyte membrane protein band 4.2
5	9606.ENSP00000371798	0.811	Fascin
6	9606.ENSP00000345259	0.773	Protein 4.1
7	9606.ENSP00000302297	0.762	Leucine-rich repeat LGI family member 3
8	9606.ENSP00000358547	0.752	55 kDa erythrocyte membrane protein
9	9606.ENSP00000252512	0.743	Exportin-7
10	9606.ENSP00000262418	0.737	Band 3 anion transport protein
11	9606.ENSP00000265080	0.716	Ras-specific guanine nucleotide-releasing factor 2
12	9606.ENSP00000264335	0.679	14-3-3 protein epsilon
13	9606.ENSP00000312634	0.675	PDZ and LIM domain protein 2
14	9606.ENSP00000259254	0.659	Glycophorin-C
15	9606.ENSP00000259365	0.638	Tropomodulin-1
16	9606.ENSP00000307199	0.621	Alpha-hemoglobin-stabilizing protein
17	9606.ENSP00000240123	0.612	Vinexin
18	9606.ENSP00000276420	0.583	Docking protein 2
19	9606.ENSP00000382972	0.582	Small nuclear ribonucleoprotein-associated protein N
20	9606.ENSP00000476767	0.576	Peptidyl-prolyl cis-trans isomerase FKBP8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043621	1.000	protein self-association
GO:0008092	0.982	cytoskeletal protein binding
GO:0003779	0.964	actin binding
GO:0044877	0.919	protein-containing complex binding
GO:0030507	0.909	spectrin binding
GO:0005102	0.880	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0030029	0.967	actin filament-based process
GO:0030036	0.962	actin cytoskeleton organization
GO:0097435	0.961	supramolecular fiber organization
GO:0051716	0.927	cellular response to stimulus
GO:0051128	0.705	regulation of cellular component organization
GO:0007015	0.660	actin filament organization
GO:0048522	0.651	positive regulation of cellular process
GO:0044085	0.531	cellular component biogenesis
GO:0022607	0.524	cellular component assembly
GO:0044087	0.517	regulation of cellular component biogenesis
GO:0042221	0.460	response to chemical
GO:0043933	0.440	protein-containing complex organization
GO:0065003	0.433	protein-containing complex assembly
GO:1901701	0.422	cellular response to oxygen-containing compound
GO:0010033	0.414	response to organic substance
GO:0050793	0.411	regulation of developmental process
GO:0051179	0.410	localization
GO:0019222	0.344	regulation of metabolic process
GO:0008360	0.338	regulation of cell shape
GO:0051171	0.334	regulation of nitrogen compound metabolic process
GO:0032501	0.326	multicellular organismal process
GO:0060255	0.323	regulation of macromolecule metabolic process
GO:0080090	0.315	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005856	1.000	cytoskeleton
GO:0005886	0.999	plasma membrane
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0031982	0.944	vesicle
GO:0030054	0.902	cell junction
GO:0031090	0.817	organelle membrane
GO:0099080	0.738	supramolecular complex
GO:0098588	0.725	bounding membrane of organelle
GO:0099081	0.707	supramolecular polymer
GO:0099512	0.702	supramolecular fiber
GO:0015629	0.694	actin cytoskeleton
GO:0031410	0.691	cytoplasmic vesicle
GO:0005938	0.600	cell cortex
GO:0098590	0.567	plasma membrane region
GO:0120025	0.510	plasma membrane bounded cell projection
GO:0030863	0.507	cortical cytoskeleton
GO:0012505	0.488	endomembrane system
GO:0099513	0.435	polymeric cytoskeletal fiber
GO:0005884	0.399	actin filament
GO:0014731	0.379	spectrin-associated cytoskeleton
GO:0045202	0.378	synapse
GO:0031095	0.368	platelet dense tubular network membrane
GO:0048471	0.305	perinuclear region of cytoplasm
GO:0031253	0.300	cell projection membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]