StarFunc result for job id Q08499

User Input

>input (809 residues)
MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPP
PPPSPQPQPQCPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRA
MDRTSYAVETGHRPGLKKSRMSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQA
NFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNF
AALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSV
SEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRP
MSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLST
PALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGF
KLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVL
LLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMC
DKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAP
DDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPL
DEQVEEEAVGEEEESQPEACVIDDRSPDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJR0	0.662	0.662	5.475E-88	809	1.000	1.000	A0A140VJR0.pdb.gz	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
2	AFDB:Q01063	0.668	0.722	1.774E-74	747	0.811	0.878	Q01063.pdb.gz	PDE4D_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Mus musculus OX=10090 GN=Pde4d PE=1 SV=2
3	PDB:4y86B	0.362	0.879	1.091E-18	326	0.119	0.294	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
4	AFDB:Q57ZK5	0.363	0.325	7.556E-16	909	0.146	0.130	Q57ZK5.pdb.gz	Q57ZK5_TRYB2 3', 5'-cyclic nucleotide phosphodiesterase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.640 PE=4 SV=1
5	PDB:6mzbB	0.361	0.362	5.820E-15	807	0.125	0.125	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
6	PDB:7jsnA	0.363	0.358	1.848E-14	820	0.135	0.133	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
7	PDB:3bjcA	0.335	0.829	3.756E-13	311	0.099	0.257	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
8	AFDB:O35177	0.071	0.070	4.700E-3	833	0.111	0.108	O35177.pdb.gz	CASL_MOUSE Enhancer of filamentation 1 OS=Mus musculus OX=10090 GN=Nedd9 PE=1 SV=2
9	AFDB:A0A1D8PLA4	0.084	0.068	1.555E-2	1196	0.140	0.094	A0A1D8PLA4.pdb.gz	A0A1D8PLA4_CANAL Zcf27p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ZCF27 PE=4 SV=1
10	AFDB:D3DTR7	0.101	0.099	1.555E-2	841	0.138	0.133	D3DTR7.pdb.gz
11	AFDB:D3ZK73	0.059	0.053	1.689E-2	971	0.104	0.087	D3ZK73.pdb.gz	D3ZK73_RAT Cullin 4B OS=Rattus norvegicus OX=10116 GN=Cul4b PE=1 SV=1
12	AFDB:O15013	0.088	0.062	1.834E-2	1369	0.101	0.060	O15013.pdb.gz	ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4
13	AFDB:P36956	0.094	0.075	1.992E-2	1147	0.145	0.102	P36956.pdb.gz	SRBP1_HUMAN Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2
14	AFDB:Q8T2I8	0.070	0.055	2.076E-2	1167	0.112	0.078	Q8T2I8.pdb.gz	SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum OX=44689 GN=sepA PE=2 SV=1
15	PDB:7b5dA	0.069	0.076	3.501E-1	701	0.048	0.056	7b5dA.pdb.gz
16	PDB:3msvA	0.076	0.140	5.745E-1	352	0.054	0.125	3msvA.pdb.gz
17	PDB:7zk3A	0.069	0.075	7.358E-1	721	0.049	0.055	7zk3A.pdb.gz	Inhibition mechanism of the chloride channel TMEM16A by the pore blocker 1PBC.
18	PDB:3aqbD	0.102	0.177	8.679E-1	325	0.041	0.102	3aqbD.pdb.gz	Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
19	PDB:3zhpA	0.078	0.144	9.044E-1	315	0.062	0.159	3zhpA.pdb.gz
20	PDB:4iggB	0.077	0.080	1.024	771	0.056	0.058	4iggB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A140VJR0	1683	809	1.000	1.000	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
2	A0A1B0GW84	1360	699	0.815	0.943	A0A1B0GW84_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=1 SV=1
3	A0A1U7QDZ1	1622	804	0.970	0.976	A0A1U7QDZ1_MESAU Phosphodiesterase OS=Mesocricetus auratus OX=10036 GN=Pde4d PE=3 SV=1
4	B1AWC8	987	659	0.616	0.756	B1AWC8_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
5	B1AWC9	990	736	0.616	0.677	B1AWC9_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
6	B1AWD0	835	564	0.515	0.739	B1AWD0_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
7	B1AWD1	647	402	0.393	0.791	B1AWD1_MOUSE 3',5'-cyclic-AMP phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
8	O89084	944	844	0.601	0.576	PDE4A_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Mus musculus OX=10090 GN=Pde4a PE=1 SV=2
9	P12252	766	1070	0.492	0.372	PDE4B_DROME cAMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=dnc PE=1 SV=4
10	P14270	1615	803	0.970	0.978	PDE4D_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Rattus norvegicus OX=10116 GN=Pde4d PE=1 SV=4
11	P14644	800	536	0.483	0.729	PDE4C_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4C (Fragment) OS=Rattus norvegicus OX=10116 GN=Pde4c PE=2 SV=2
12	P14646	989	736	0.617	0.678	PDE4B_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4B OS=Rattus norvegicus OX=10116 GN=Pde4b PE=1 SV=4
13	P27815	942	886	0.623	0.569	PDE4A_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Homo sapiens OX=9606 GN=PDE4A PE=1 SV=3
14	P54748	925	844	0.597	0.572	PDE4A_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Rattus norvegicus OX=10116 GN=Pde4a PE=1 SV=1
15	Q01063	1328	747	0.800	0.866	PDE4D_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Mus musculus OX=10090 GN=Pde4d PE=1 SV=2
16	Q07343	982	736	0.612	0.673	PDE4B_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4B OS=Homo sapiens OX=9606 GN=PDE4B PE=1 SV=1
17	Q08493	954	712	0.580	0.659	PDE4C_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4C OS=Homo sapiens OX=9606 GN=PDE4C PE=1 SV=2
18	Q08499	1683	809	1.000	1.000	PDE4D_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Homo sapiens OX=9606 GN=PDE4D PE=1 SV=2
19	Q22000	634	674	0.405	0.487	PDE4_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-4 OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=2 SV=2
20	Q2V4U0	632	673	0.394	0.474	Q2V4U0_CAEEL Phosphodiesterase OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18100 PDE4_UCR	2.9e-56	200.7	Phosphodiesterase 4 upstream conserved regions (UCR)
2	PF00233 PDEase_I	6.4e-87	302.7	3'5'-cyclic nucleotide phosphodiesterase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345502

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309591	0.972	cAMP-dependent protein kinase catalytic subunit alpha
2	9606.ENSP00000305372	0.967	Beta-2 adrenergic receptor
3	9606.ENSP00000262187	0.962	GTP-binding protein Rheb
4	9606.ENSP00000440045	0.944	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
5	9606.ENSP00000426909	0.928	Receptor of activated protein C kinase 1
6	9606.ENSP00000469689	0.923	SH3 and multiple ankyrin repeat domains protein 2
7	9606.ENSP00000358363	0.922	Myomegalin
8	9606.ENSP00000371230	0.914	GTP:AMP phosphotransferase AK3, mitochondrial
9	9606.ENSP00000286621	0.913	Adenosine kinase
10	9606.ENSP00000286648	0.911	Deoxycytidine kinase
11	9606.ENSP00000485525	0.906	Adenylosuccinate lyase
12	9606.ENSP00000367615	0.900	Adenine phosphoribosyltransferase
13	9606.ENSP00000355593	0.895	Disrupted in schizophrenia 1 protein
14	9606.ENSP00000384537	0.887	A-kinase anchor protein 12
15	9606.ENSP00000294016	0.870	Adenylate cyclase type 9
16	9606.ENSP00000419361	0.849	Adenylate cyclase type 5
17	9606.ENSP00000468057	0.846	Heat shock protein beta-6
18	9606.ENSP00000312126	0.844	Adenylate cyclase type 4
19	9606.ENSP00000359719	0.843	cAMP-dependent protein kinase catalytic subunit beta
20	9606.ENSP00000378187	0.841	Adenylate cyclase type 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0004115	0.999	3',5'-cyclic-AMP phosphodiesterase activity
GO:0036094	0.997	small molecule binding
GO:1901265	0.997	nucleoside phosphate binding
GO:0044325	0.940	transmembrane transporter binding
GO:0051117	0.935	ATPase binding
GO:0000166	0.816	nucleotide binding
GO:0030551	0.808	cyclic nucleotide binding
GO:0097367	0.783	carbohydrate derivative binding
GO:0005102	0.744	signaling receptor binding
GO:0017076	0.702	purine nucleotide binding
GO:0043168	0.695	anion binding
GO:0032559	0.659	adenyl ribonucleotide binding
GO:0030552	0.653	cAMP binding
GO:0001664	0.406	G protein-coupled receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050896	0.996	response to stimulus
GO:0051716	0.994	cellular response to stimulus
GO:0050794	0.975	regulation of cellular process
GO:0032501	0.943	multicellular organismal process
GO:1901701	0.905	cellular response to oxygen-containing compound
GO:0010033	0.841	response to organic substance
GO:0010646	0.841	regulation of cell communication
GO:0010243	0.832	response to organonitrogen compound
GO:0048583	0.812	regulation of response to stimulus
GO:0071495	0.789	cellular response to endogenous stimulus
GO:0023051	0.775	regulation of signaling
GO:1901699	0.759	cellular response to nitrogen compound
GO:0071417	0.735	cellular response to organonitrogen compound
GO:0014074	0.731	response to purine-containing compound
GO:0007165	0.702	signal transduction
GO:0046683	0.700	response to organophosphorus
GO:0071407	0.610	cellular response to organic cyclic compound
GO:0051591	0.574	response to cAMP
GO:0071320	0.539	cellular response to cAMP
GO:0048518	0.476	positive regulation of biological process
GO:0051239	0.466	regulation of multicellular organismal process
GO:0060255	0.450	regulation of macromolecule metabolic process
GO:0008152	0.409	metabolic process
GO:0044237	0.398	cellular metabolic process
GO:0080090	0.398	regulation of primary metabolic process
GO:0051171	0.398	regulation of nitrogen compound metabolic process
GO:0031323	0.395	regulation of cellular metabolic process
GO:0003008	0.394	system process
GO:0071704	0.379	organic substance metabolic process
GO:0065008	0.333	regulation of biological quality
GO:0044238	0.332	primary metabolic process
GO:0048523	0.315	negative regulation of cellular process
GO:0006807	0.309	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.998	plasma membrane
GO:0043227	0.944	membrane-bounded organelle
GO:0032991	0.887	protein-containing complex
GO:0043229	0.847	intracellular organelle
GO:0043231	0.828	intracellular membrane-bounded organelle
GO:0012505	0.758	endomembrane system
GO:0043232	0.750	intracellular non-membrane-bounded organelle
GO:0015630	0.631	microtubule cytoskeleton
GO:0005815	0.576	microtubule organizing center
GO:0005813	0.540	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:25277	0.999	3',5'-cyclic AMP + H2O = AMP + H(+)
EC:3.1.4.53	0.999	3',5'-cyclic-AMP phosphodiesterase.

[back to server]