StarFunc result for job id Q08722

User Input

>input (323 residues)
MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKF
KGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELT
REGETIIELKYRVVSWFSPNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALL
VAGLVITVIVIVGAILFVPGEYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIA
ILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQ
PPRKAVEEPLNAFKESKGMMNDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08722	1.000	1.000	7.054E-58	323	1.000	1.000	Q08722.pdb.gz	CD47_HUMAN Leukocyte surface antigen CD47 OS=Homo sapiens OX=9606 GN=CD47 PE=1 SV=1
2	AFDB:P97829	0.876	0.931	3.608E-40	303	0.663	0.706	P97829.pdb.gz	CD47_RAT Leukocyte surface antigen CD47 OS=Rattus norvegicus OX=10116 GN=Cd47 PE=1 SV=1
3	AFDB:Q4QTK1	0.336	0.374	2.653E-8	287	0.084	0.094	Q4QTK1.pdb.gz	Q4QTK1_PIG CD274 molecule OS=Sus scrofa OX=9823 GN=CD274 PE=2 SV=1
4	AFDB:D4AE25	0.335	0.370	4.068E-8	290	0.077	0.086	D4AE25.pdb.gz	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2
5	AFDB:Q16653	0.348	0.435	4.776E-8	247	0.105	0.138	Q16653.pdb.gz	MOG_HUMAN Myelin-oligodendrocyte glycoprotein OS=Homo sapiens OX=9606 GN=MOG PE=1 SV=2
6	AFDB:Q7TSP5	0.341	0.386	5.914E-8	283	0.077	0.088	Q7TSP5.pdb.gz	VTCN1_MOUSE V-set domain containing T-cell activation inhibitor 1 OS=Mus musculus OX=10090 GN=Vtcn1 PE=1 SV=1
7	AFDB:Q9EP73	0.335	0.369	9.069E-8	290	0.074	0.083	Q9EP73.pdb.gz	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
8	AFDB:Q61885	0.349	0.443	1.817E-7	246	0.133	0.175	Q61885.pdb.gz	MOG_MOUSE Myelin-oligodendrocyte glycoprotein OS=Mus musculus OX=10090 GN=Mog PE=1 SV=1
9	AFDB:Q68D85	0.327	0.241	1.916E-7	454	0.084	0.059	Q68D85.pdb.gz	NR3L1_HUMAN Natural cytotoxicity triggering receptor 3 ligand 1 OS=Homo sapiens OX=9606 GN=NCR3LG1 PE=1 SV=1
10	AFDB:Q9NZQ7	0.323	0.356	3.450E-7	290	0.065	0.072	Q9NZQ7.pdb.gz	PD1L1_HUMAN Programmed cell death 1 ligand 1 OS=Homo sapiens OX=9606 GN=CD274 PE=1 SV=1
11	PDB:3oaiA	0.289	0.196	1.413E-5	488	0.056	0.037	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
12	PDB:6dldD	0.247	0.291	4.831E-5	269	0.074	0.089	6dldD.pdb.gz
13	PDB:1cd0A	0.241	0.600	7.023E-5	111	0.077	0.225	1cd0A.pdb.gz
14	PDB:2cd0A	0.261	0.668	7.023E-5	111	0.062	0.180	2cd0A.pdb.gz
15	PDB:1ngwH	0.249	0.350	8.244E-5	216	0.059	0.088	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
16	PDB:4adfM	0.246	0.395	3.681E-4	191	0.059	0.099	4adfM.pdb.gz
17	PDB:6dlfA	0.261	0.347	5.351E-4	236	0.056	0.076	6dlfA.pdb.gz
18	PDB:1ohqA	0.247	0.567	8.206E-4	120	0.053	0.142	1ohqA.pdb.gz
19	PDB:1a8jL	0.250	0.352	9.132E-4	216	0.074	0.111	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
20	PDB:4edqA	0.216	0.149	9.132E-4	483	0.084	0.056	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08722	0.0	655	323	1.000	1.000	CD47_HUMAN Leukocyte surface antigen CD47 OS=Homo sapiens OX=9606 GN=CD47 PE=1 SV=1
2	Q61735	2.48e-153	433	303	0.659	0.703	CD47_MOUSE Leukocyte surface antigen CD47 OS=Mus musculus OX=10090 GN=Cd47 PE=1 SV=2
3	P97829	2.25e-151	428	303	0.663	0.706	CD47_RAT Leukocyte surface antigen CD47 OS=Rattus norvegicus OX=10116 GN=Cd47 PE=1 SV=1
4	Q9W260	0.11	36.6	500	0.130	0.084	Q9W260_DROME GH03113p OS=Drosophila melanogaster OX=7227 GN=wrapper PE=1 SV=2
5	Q9XZB7	0.12	36.6	500	0.130	0.084	Q9XZB7_DROME Wrapper protein OS=Drosophila melanogaster OX=7227 GN=wrapper PE=2 SV=1
6	Q9Y279	0.39	34.7	399	0.099	0.080	VSIG4_HUMAN V-set and immunoglobulin domain-containing protein 4 OS=Homo sapiens OX=9606 GN=VSIG4 PE=1 SV=1
7	F6TUL9	1.8	32.3	280	0.065	0.075	F6TUL9_MOUSE V-set and immunoglobulin domain containing 4 OS=Mus musculus OX=10090 GN=Vsig4 PE=1 SV=1
8	Q9M153	3.1	32.0	382	0.050	0.042	GDL61_ARATH GDSL esterase/lipase At4g01130 OS=Arabidopsis thaliana OX=3702 GN=At4g01130 PE=2 SV=1
9	A0A8I6AIJ0	4.1	31.2	281	0.084	0.096	A0A8I6AIJ0_RAT V-set and immunoglobulin domain containing 4 OS=Rattus norvegicus OX=10116 GN=Vsig4 PE=1 SV=1
10	P52166	4.6	31.6	444	0.149	0.108	PSN_CAEEL Presenilin sel-12 OS=Caenorhabditis elegans OX=6239 GN=sel-12 PE=1 SV=2
11	F7FEU1	4.8	31.2	285	0.084	0.095	F7FEU1_RAT V-set and immunoglobulin domain containing 4 OS=Rattus norvegicus OX=10116 GN=Vsig4 PE=1 SV=1
12	Q61144	6.7	30.8	448	0.130	0.094	PSN2_MOUSE Presenilin-2 OS=Mus musculus OX=10090 GN=Psen2 PE=1 SV=3
13	B0V1H3	6.8	30.8	478	0.087	0.059	B0V1H3_DANRE CARD-like protein OS=Danio rerio OX=7955 GN=Gene2604 PE=2 SV=1
14	B5XKM7	9.1	30.4	435	0.065	0.048	ENO_STRPZ Enolase OS=Streptococcus pyogenes serotype M49 (strain NZ131) OX=471876 GN=eno PE=3 SV=1
15	Q1J7I5	9.1	30.4	435	0.065	0.048	ENO_STRPF Enolase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) OX=370554 GN=eno PE=3 SV=1
16	Q1JHQ6	9.1	30.4	435	0.065	0.048	ENO_STRPD Enolase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) OX=370552 GN=eno PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04549 CD47	2.4e-49	178.8	CD47 transmembrane region
2	PF07679 I-set	2.9e+02	12.9	Immunoglobulin I-set domain
3	PF00047 ig	3.2e+02	12.9	Immunoglobulin domain
4	PF13927 Ig_3	55	15.7	Immunoglobulin domain
5	PF07686 V-set	0.66	21.6	Immunoglobulin V-set domain
6	PF08204 V-set_CD47	2.6e-50	181.2	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355361

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260356	0.999	Thrombospondin-1
2	9606.ENSP00000305529	0.999	Signal-regulatory protein gamma
3	9606.ENSP00000382941	0.999	Tyrosine-protein phosphatase non-receptor type substrate 1
4	9606.ENSP00000355751	0.994	Thrombospondin-2
5	9606.ENSP00000263923	0.987	Vascular endothelial growth factor receptor 2
6	9606.ENSP00000365576	0.977	Ubiquilin-1
7	9606.ENSP00000261023	0.966	Integrin alpha-V
8	9606.ENSP00000452786	0.965	Integrin beta-3
9	9606.ENSP00000362680	0.955	Proto-oncogene tyrosine-protein kinase Src
10	9606.ENSP00000299481	0.942	NACHT, LRR and PYD domains-containing protein 14
11	9606.ENSP00000262407	0.936	Integrin alpha-IIb
12	9606.ENSP00000341189	0.935	Focal adhesion kinase 1
13	9606.ENSP00000357625	0.933	BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
14	9606.ENSP00000371018	0.932	Signal-regulatory protein beta-1
15	9606.ENSP00000339730	0.931	Thrombospondin-4
16	9606.ENSP00000360217	0.926	Ammonium transporter Rh type A
17	9606.ENSP00000427690	0.907	Glycophorin-B
18	9606.ENSP00000364979	0.906	Collagen alpha-1(IV) chain
19	9606.ENSP00000353654	0.905	Collagen alpha-2(IV) chain
20	9606.ENSP00000379823	0.905	Collagen alpha-3(IV) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0098632	1.000	cell-cell adhesion mediator activity
GO:0070053	0.747	thrombospondin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050896	0.995	response to stimulus
GO:0050794	0.994	regulation of cellular process
GO:0019222	0.987	regulation of metabolic process
GO:0007154	0.986	cell communication
GO:0023052	0.985	signaling
GO:0002684	0.985	positive regulation of immune system process
GO:0007165	0.982	signal transduction
GO:0051239	0.971	regulation of multicellular organismal process
GO:0060255	0.971	regulation of macromolecule metabolic process
GO:0001817	0.959	regulation of cytokine production
GO:0030155	0.958	regulation of cell adhesion
GO:0048522	0.958	positive regulation of cellular process
GO:0042221	0.920	response to chemical
GO:0007166	0.919	cell surface receptor signaling pathway
GO:0050865	0.917	regulation of cell activation
GO:0002694	0.897	regulation of leukocyte activation
GO:0051179	0.889	localization
GO:0051240	0.887	positive regulation of multicellular organismal process
GO:0010033	0.849	response to organic substance
GO:0051234	0.836	establishment of localization
GO:0006810	0.832	transport
GO:0070887	0.817	cellular response to chemical stimulus
GO:0022407	0.801	regulation of cell-cell adhesion
GO:0051249	0.778	regulation of lymphocyte activation
GO:0042127	0.723	regulation of cell population proliferation
GO:0032649	0.723	regulation of type II interferon production
GO:0071310	0.722	cellular response to organic substance
GO:0015748	0.715	organophosphate ester transport
GO:0015931	0.709	nucleobase-containing compound transport
GO:0015865	0.704	purine nucleotide transport
GO:1903037	0.701	regulation of leukocyte cell-cell adhesion
GO:0045785	0.701	positive regulation of cell adhesion
GO:0048583	0.687	regulation of response to stimulus
GO:0048519	0.685	negative regulation of biological process
GO:0008284	0.664	positive regulation of cell population proliferation
GO:0051503	0.654	adenine nucleotide transport
GO:0015868	0.645	purine ribonucleotide transport
GO:0050867	0.623	positive regulation of cell activation
GO:0002696	0.596	positive regulation of leukocyte activation
GO:0007229	0.588	integrin-mediated signaling pathway
GO:0015867	0.576	ATP transport
GO:0050863	0.553	regulation of T cell activation
GO:0009893	0.529	positive regulation of metabolic process
GO:0022409	0.522	positive regulation of cell-cell adhesion
GO:0051251	0.520	positive regulation of lymphocyte activation
GO:0048523	0.512	negative regulation of cellular process
GO:0050870	0.498	positive regulation of T cell activation
GO:0002376	0.496	immune system process
GO:0006950	0.491	response to stress
GO:0034097	0.475	response to cytokine
GO:0010604	0.422	positive regulation of macromolecule metabolic process
GO:0031323	0.407	regulation of cellular metabolic process
GO:0051171	0.398	regulation of nitrogen compound metabolic process
GO:0071345	0.398	cellular response to cytokine stimulus
GO:0048584	0.397	positive regulation of response to stimulus
GO:0032655	0.372	regulation of interleukin-12 production
GO:0032653	0.367	regulation of interleukin-10 production
GO:0032675	0.352	regulation of interleukin-6 production
GO:0032879	0.346	regulation of localization
GO:0032501	0.316	multicellular organismal process
GO:0009605	0.313	response to external stimulus
GO:0051049	0.302	regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031982	1.000	vesicle
GO:0005886	1.000	plasma membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0009986	0.992	cell surface
GO:0030659	0.975	cytoplasmic vesicle membrane
GO:0099503	0.968	secretory vesicle
GO:0030141	0.960	secretory granule
GO:0005576	0.943	extracellular region
GO:0098588	0.928	bounding membrane of organelle
GO:0005615	0.868	extracellular space
GO:0043230	0.868	extracellular organelle
GO:1903561	0.856	extracellular vesicle
GO:0070062	0.839	extracellular exosome
GO:0030667	0.712	secretory granule membrane
GO:0070820	0.451	tertiary granule
GO:0070013	0.369	intracellular organelle lumen
GO:0042581	0.340	specific granule
GO:0005634	0.333	nucleus
GO:0035579	0.323	specific granule membrane
GO:0070821	0.321	tertiary granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]