StarFunc result for job id Q08752

User Input

>input (370 residues)
MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGH
TTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
ANAGRNTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAE
CGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIGNTFFKSQNWE
MAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEAL
ELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDK
EKAVYAKMFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E5KN55	0.998	0.998	5.308E-68	370	1.000	1.000	E5KN55.pdb.gz	E5KN55_HUMAN Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 PE=1 SV=1
2	PDB:1ihgA	0.968	0.984	4.974E-62	364	0.916	0.931	1ihgA.pdb.gz
3	AFDB:E1BXG9	0.977	0.977	7.839E-62	370	0.816	0.816	E1BXG9.pdb.gz	E1BXG9_CHICK Peptidylprolyl isomerase D OS=Gallus gallus OX=9031 GN=PPID PE=1 SV=2
4	AFDB:Q9C566	0.902	0.923	2.405E-41	361	0.465	0.476	Q9C566.pdb.gz	CYP40_ARATH Peptidyl-prolyl cis-trans isomerase CYP40 OS=Arabidopsis thaliana OX=3702 GN=CYP40 PE=2 SV=1
5	AFDB:P53691	0.729	0.727	4.132E-39	371	0.449	0.447	P53691.pdb.gz	PPID_YEAST Peptidyl-prolyl cis-trans isomerase CPR6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CPR6 PE=1 SV=1
6	AFDB:E9AFV2	0.772	0.803	1.578E-38	354	0.427	0.446	E9AFV2.pdb.gz	E9AFV2_LEIMA Cyclophilin 40 OS=Leishmania major OX=5664 GN=CYP40 PE=4 SV=1
7	AFDB:Q9VT21	0.778	0.755	6.376E-37	383	0.389	0.376	Q9VT21.pdb.gz	Q9VT21_DROME Cyclophilin 40, isoform A OS=Drosophila melanogaster OX=7227 GN=Cyp40 PE=2 SV=1
8	AFDB:Q11004	0.774	0.800	1.970E-35	356	0.422	0.438	Q11004.pdb.gz	PPID_SCHPO 40 kDa peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wis2 PE=2 SV=1
9	AFDB:P47103	0.723	0.687	8.903E-32	393	0.335	0.316	P47103.pdb.gz	CYP7_YEAST Peptidyl-prolyl cis-trans isomerase CYP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CPR7 PE=1 SV=1
10	PDB:5jheA	0.724	0.696	1.568E-30	388	0.332	0.317	5jheA.pdb.gz
11	AFDB:Q8IGV4	0.472	0.175	5.563E-27	1002	0.303	0.112	Q8IGV4.pdb.gz	Q8IGV4_DROME RE23622p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Moca-cyp PE=2 SV=1
12	AFDB:Q13427	0.464	0.228	1.243E-26	754	0.292	0.143	Q13427.pdb.gz	PPIG_HUMAN Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens OX=9606 GN=PPIG PE=1 SV=2
13	PDB:1e3bA	0.457	0.977	3.734E-26	172	0.308	0.663	1e3bA.pdb.gz	First Crystal Structure of a Medicinally Relevant Gold Protein Complex:Unexpected Binding of [Au(Pet (3))](+) to Histidine
14	PDB:5yzg3	0.457	0.984	3.362E-25	171	0.289	0.626	5yzg3.pdb.gz	Structure of a human catalytic step I spliceosome
15	PDB:1mzwA	0.447	0.945	2.195E-24	173	0.276	0.590	1mzwA.pdb.gz
16	PDB:1vdnA	0.425	0.969	3.968E-23	161	0.268	0.615	1vdnA.pdb.gz	Crystal Structure Of Yeast Cyclophilin A Complexed With ACE-Ala-Ala-Pro-Ala-7-Amino-4-Methylcoumarin
17	PDB:5yzg1	0.437	0.663	7.550E-23	243	0.268	0.407	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:4n1mA	0.433	0.946	1.099E-22	168	0.276	0.607	4n1mA.pdb.gz	Mapping the binding surface of Cyclophilin A.
19	PDB:3iciA	0.436	0.859	2.206E-22	187	0.254	0.503	3iciA.pdb.gz	Structural Basis of Cyclophilin B Binding by the Calnexin/Calreticulin P-domain.
20	PDB:1h0pA	0.424	0.857	2.327E-22	182	0.246	0.500	1h0pA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E1BXG9	0.0	621	370	0.816	0.816	E1BXG9_CHICK Peptidylprolyl isomerase D OS=Gallus gallus OX=9031 GN=PPID PE=1 SV=2
2	E5KN55	0.0	763	370	1.000	1.000	E5KN55_HUMAN Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 PE=1 SV=1
3	P26882	0.0	722	370	0.938	0.938	PPID_BOVIN Peptidyl-prolyl cis-trans isomerase D OS=Bos taurus OX=9913 GN=PPID PE=1 SV=6
4	Q08752	0.0	763	370	1.000	1.000	PPID_HUMAN Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3
5	Q6DGG0	0.0	714	370	0.935	0.935	PPID_RAT Peptidyl-prolyl cis-trans isomerase D OS=Rattus norvegicus OX=10116 GN=Ppid PE=1 SV=3
6	Q9CR16	0.0	720	370	0.943	0.943	PPID_MOUSE Peptidyl-prolyl cis-trans isomerase D OS=Mus musculus OX=10090 GN=Ppid PE=1 SV=3
7	Q9C566	5.96e-110	327	361	0.476	0.488	CYP40_ARATH Peptidyl-prolyl cis-trans isomerase CYP40 OS=Arabidopsis thaliana OX=3702 GN=CYP40 PE=2 SV=1
8	P53691	1.90e-96	293	371	0.459	0.458	PPID_YEAST Peptidyl-prolyl cis-trans isomerase CPR6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CPR6 PE=1 SV=1
9	E9AFV2	5.22e-95	289	354	0.430	0.449	E9AFV2_LEIMA Cyclophilin 40 OS=Leishmania major OX=5664 GN=CYP40 PE=4 SV=1
10	Q9VT21	1.55e-85	266	383	0.400	0.386	Q9VT21_DROME Cyclophilin 40, isoform A OS=Drosophila melanogaster OX=7227 GN=Cyp40 PE=2 SV=1
11	Q11004	8.68e-85	263	356	0.438	0.455	PPID_SCHPO 40 kDa peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wis2 PE=2 SV=1
12	Q9SKQ0	8.38e-76	233	174	0.305	0.649	CP19B_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Arabidopsis thaliana OX=3702 GN=CYP19-2 PE=2 SV=1
13	P52011	8.36e-75	231	173	0.308	0.659	CYP3_CAEEL Peptidyl-prolyl cis-trans isomerase 3 OS=Caenorhabditis elegans OX=6239 GN=cyn-3 PE=1 SV=1
14	Q54SM3	2.38e-74	230	179	0.303	0.626	PPIA_DICDI Peptidyl-prolyl cis-trans isomerase A OS=Dictyostelium discoideum OX=44689 GN=ppiA PE=1 SV=1
15	P52009	2.59e-74	230	192	0.308	0.594	CYP1_CAEEL Peptidyl-prolyl cis-trans isomerase 1 OS=Caenorhabditis elegans OX=6239 GN=cyn-1 PE=2 SV=1
16	P21569	4.49e-74	229	172	0.297	0.640	CYPH_MAIZE Peptidyl-prolyl cis-trans isomerase OS=Zea mays OX=4577 GN=CYP PE=2 SV=1
17	P34790	7.08e-74	228	172	0.300	0.645	CP18C_ARATH Peptidyl-prolyl cis-trans isomerase CYP18-3 OS=Arabidopsis thaliana OX=3702 GN=CYP18-3 PE=1 SV=1
18	G8XQW2	9.92e-74	228	173	0.297	0.636	G8XQW2_GOSHI Peptidyl-prolyl cis-trans isomerase OS=Gossypium hirsutum OX=3635 GN=LOC107916701 PE=2 SV=1
19	Q38900	1.86e-73	228	173	0.295	0.630	CP19A_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Arabidopsis thaliana OX=3702 GN=CYP19-1 PE=1 SV=1
20	Q9LY75	5.99e-73	239	570	0.308	0.200	CYP63_ARATH Peptidyl-prolyl cis-trans isomerase CYP63 OS=Arabidopsis thaliana OX=3702 GN=CYP63 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	2.7e+02	13.2	Anaphase-promoting complex, cyclosome, subunit 3
2	PF00160 Pro_isomerase	2.2e-43	159.7	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
3	PF00515 TPR_1	8.4e-13	58.7	Tetratricopeptide repeat
4	PF13414 TPR_11	0.0062	27.5	TPR repeat
5	PF13424 TPR_12	0.053	25.1	Tetratricopeptide repeat
6	PF13428 TPR_14	33	16.6	Tetratricopeptide repeat
7	PF13432 TPR_16	9.4	18.2	Tetratricopeptide repeat
8	PF13431 TPR_17	1.5e+02	14.1	Tetratricopeptide repeat
9	PF14559 TPR_19	1.2e+02	14.6	Tetratricopeptide repeat
10	PF07719 TPR_2	3.5e-10	50.2	Tetratricopeptide repeat
11	PF13174 TPR_6	1.1e+02	14.9	Tetratricopeptide repeat
12	PF13176 TPR_7	0.00086	30.2	Tetratricopeptide repeat
13	PF13181 TPR_8	72	15.0	Tetratricopeptide repeat
14	PF13371 TPR_9	3.1e+02	12.9	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303754

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335153	0.999	Heat shock protein HSP 90-alpha
2	9606.ENSP00000360609	0.984	Heat shock protein HSP 90-beta
3	9606.ENSP00000482075	0.982	Prostaglandin E synthase 3
4	9606.ENSP00000292169	0.981	Protein S100-A1
5	9606.ENSP00000351646	0.965	Stress-induced-phosphoprotein 1
6	9606.ENSP00000265333	0.954	Voltage-dependent anion-selective channel protein 1
7	9606.ENSP00000001008	0.945	Peptidyl-prolyl cis-trans isomerase FKBP4
8	9606.ENSP00000405330	0.943	Estrogen receptor
9	9606.ENSP00000012443	0.940	Serine/threonine-protein phosphatase 5
10	9606.ENSP00000444810	0.940	Peptidyl-prolyl cis-trans isomerase FKBP5
11	9606.ENSP00000215832	0.929	Mitogen-activated protein kinase 1
12	9606.ENSP00000339992	0.927	Transcriptional activator Myb
13	9606.ENSP00000263025	0.910	Mitogen-activated protein kinase 3
14	9606.ENSP00000281456	0.910	ADP/ATP translocase 1
15	9606.ENSP00000254322	0.902	DnaJ homolog subfamily B member 1
16	9606.ENSP00000216479	0.886	Activator of 90 kDa heat shock protein ATPase homolog 1
17	9606.ENSP00000361635	0.882	Voltage-dependent anion-selective channel protein 2
18	9606.ENSP00000370808	0.880	ADP/ATP translocase 3
19	9606.ENSP00000281154	0.875	ADP/ATP translocase 4
20	9606.ENSP00000428845	0.873	Voltage-dependent anion-selective channel protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031072	0.999	heat shock protein binding
GO:0008134	0.999	transcription factor binding
GO:0033218	0.998	amide binding
GO:0016853	0.995	isomerase activity
GO:0003755	0.993	peptidyl-prolyl cis-trans isomerase activity
GO:0016018	0.884	cyclosporin A binding
GO:0140297	0.755	DNA-binding transcription factor binding
GO:0097159	0.574	organic cyclic compound binding
GO:1901363	0.568	heterocyclic compound binding
GO:0019899	0.428	enzyme binding
GO:0003676	0.393	nucleic acid binding
GO:0061629	0.325	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0071704	0.956	organic substance metabolic process
GO:0044238	0.950	primary metabolic process
GO:0006807	0.942	nitrogen compound metabolic process
GO:0043170	0.920	macromolecule metabolic process
GO:0050789	0.916	regulation of biological process
GO:0050794	0.904	regulation of cellular process
GO:0006457	0.728	protein folding
GO:0050896	0.640	response to stimulus
GO:1901564	0.620	organonitrogen compound metabolic process
GO:0019538	0.548	protein metabolic process
GO:0048518	0.500	positive regulation of biological process
GO:0048519	0.483	negative regulation of biological process
GO:0048523	0.426	negative regulation of cellular process
GO:0019222	0.373	regulation of metabolic process
GO:0048522	0.341	positive regulation of cellular process
GO:0060255	0.335	regulation of macromolecule metabolic process
GO:0031323	0.325	regulation of cellular metabolic process
GO:0051171	0.318	regulation of nitrogen compound metabolic process
GO:0018193	0.316	peptidyl-amino acid modification
GO:0080090	0.310	regulation of primary metabolic process
GO:0018208	0.308	peptidyl-proline modification
GO:0006950	0.303	response to stress
GO:0071840	0.302	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.995	nucleoplasm
GO:0043232	0.975	intracellular non-membrane-bounded organelle
GO:0005829	0.974	cytosol
GO:0005739	0.659	mitochondrion
GO:0005730	0.461	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.-.-.-	0.995	Isomerases.
RHEA:16237	0.993	[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0)
EC:5.2.1.8	0.993	peptidylprolyl isomerase.

[back to server]