StarFunc result for job id Q08881

User Input

>input (620 residues)
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKY
HPNFWMDGKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALY
DYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWY
NKSISRDKAEKLLLDTGKEGAFMVRDSRTAGTYTVSVFTKAVVSENNPCIKHYHIKETND
NPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAGLRYGKWVIDP
SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQ
LYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIH
RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD
VWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPE
DRPAFSRLLRQLAEIAESGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03526	0.705	0.699	2.006E-101	625	0.940	0.933	Q03526.pdb.gz	ITK_MOUSE Tyrosine-protein kinase ITK/TSK OS=Mus musculus OX=10090 GN=Itk PE=1 SV=1
2	AFDB:A0A0G2KA94	0.684	0.631	2.343E-79	674	0.587	0.540	A0A0G2KA94.pdb.gz	A0A0G2KA94_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
3	AFDB:Q8JH64	0.688	0.650	9.748E-72	657	0.524	0.495	Q8JH64.pdb.gz	BTK_CHICK Tyrosine-protein kinase BTK OS=Gallus gallus OX=9031 GN=BTK PE=1 SV=1
4	AFDB:A0A0G2K134	0.692	0.649	2.361E-71	662	0.515	0.482	A0A0G2K134.pdb.gz	A0A0G2K134_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
5	AFDB:F8W3B7	0.615	0.597	6.960E-71	640	0.518	0.502	F8W3B7.pdb.gz	F8W3B7_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=btk PE=3 SV=1
6	AFDB:P51813	0.439	0.403	2.643E-62	675	0.487	0.447	P51813.pdb.gz	BMX_HUMAN Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens OX=9606 GN=BMX PE=1 SV=1
7	AFDB:P08630	0.649	0.519	1.283E-60	786	0.448	0.354	P08630.pdb.gz	BTKL_DROME Tyrosine-protein kinase Btk OS=Drosophila melanogaster OX=7227 GN=Btk PE=2 SV=2
8	AFDB:P42682	0.695	0.815	2.876E-57	527	0.439	0.516	P42682.pdb.gz	TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus OX=10090 GN=Txk PE=1 SV=1
9	AFDB:P42681	0.681	0.797	1.540E-55	527	0.448	0.528	P42681.pdb.gz	TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens OX=9606 GN=TXK PE=1 SV=3
10	AFDB:A0A0G2K6M9	0.619	0.695	2.112E-52	550	0.450	0.507	A0A0G2K6M9.pdb.gz	A0A0G2K6M9_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
11	PDB:2h8hA	0.585	0.787	2.027E-39	445	0.266	0.371	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.404	0.560	4.876E-33	441	0.247	0.347	1k9aB.pdb.gz
13	PDB:4fl2A	0.408	0.454	1.428E-26	555	0.205	0.229	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.407	0.455	7.227E-26	551	0.197	0.221	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:6s73A	0.364	0.798	2.402E-15	269	0.102	0.234	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
16	PDB:8dksA	0.335	0.689	2.523E-15	283	0.116	0.254	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
17	PDB:1unlA	0.354	0.716	2.803E-14	292	0.094	0.199	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
18	PDB:5ufuA	0.346	0.563	3.765E-14	369	0.100	0.168	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
19	PDB:3eqdA	0.368	0.689	4.582E-14	315	0.103	0.203	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
20	PDB:4rerA	0.348	0.461	5.578E-14	459	0.100	0.135	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K134	604	637	0.510	0.496	A0A0G2K134_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
2	A0A0G2K6M9	662	661	0.539	0.505	A0A0G2K6M9_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=3 SV=2
3	A0A0G2KA94	756	674	0.584	0.537	A0A0G2KA94_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
4	A0A8I5ZXG2	716	607	0.565	0.577	A0A8I5ZXG2_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
5	A0A8I6A3K6	733	681	0.566	0.515	A0A8I6A3K6_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
6	A0A8I6GBZ8	711	602	0.560	0.576	A0A8I6GBZ8_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
7	B2RYC7	756	629	0.584	0.576	B2RYC7_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
8	F8W3B7	628	640	0.515	0.498	F8W3B7_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=btk PE=3 SV=1
9	P24604	744	630	0.577	0.568	TEC_MOUSE Tyrosine-protein kinase Tec OS=Mus musculus OX=10090 GN=Tec PE=1 SV=2
10	P35991	662	659	0.537	0.505	BTK_MOUSE Tyrosine-protein kinase BTK OS=Mus musculus OX=10090 GN=Btk PE=1 SV=4
11	P42680	762	631	0.585	0.575	TEC_HUMAN Tyrosine-protein kinase Tec OS=Homo sapiens OX=9606 GN=TEC PE=1 SV=2
12	P42681	565	527	0.432	0.509	TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens OX=9606 GN=TXK PE=1 SV=3
13	P42682	564	527	0.426	0.501	TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus OX=10090 GN=Txk PE=1 SV=1
14	P51813	569	675	0.485	0.446	BMX_HUMAN Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens OX=9606 GN=BMX PE=1 SV=1
15	Q03526	1210	625	0.942	0.934	ITK_MOUSE Tyrosine-protein kinase ITK/TSK OS=Mus musculus OX=10090 GN=Itk PE=1 SV=1
16	Q06187	653	659	0.527	0.496	BTK_HUMAN Tyrosine-protein kinase BTK OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=3
17	Q08881	1299	620	1.000	1.000	ITK_HUMAN Tyrosine-protein kinase ITK/TSK OS=Homo sapiens OX=9606 GN=ITK PE=1 SV=1
18	Q5S255	662	660	0.539	0.506	Q5S255_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Btk PE=2 SV=1
19	Q8JH64	648	657	0.532	0.502	BTK_CHICK Tyrosine-protein kinase BTK OS=Gallus gallus OX=9031 GN=BTK PE=1 SV=1
20	U3NG26	548	568	0.453	0.495	U3NG26_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	69	14.0	ABC1 atypical kinase-like domain
2	PF01636 APH	4.7e+02	12.0	Phosphotransferase enzyme family
3	PF00779 BTK	1.2e-09	49.1	BTK motif
4	PF00169 PH	1.5e-10	52.8	PH domain
5	PF14593 PH_3	2.1e+02	13.3	PH domain
6	PF15409 PH_8	2.5	19.8	Pleckstrin homology domain
7	PF00069 Pkinase	2.2e-43	160.1	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	9.2e-89	308.7	Protein tyrosine and serine/threonine kinase
9	PF00017 SH2	4.4e-18	76.5	SH2 domain
10	PF00018 SH3_1	2.1e-11	54.5	SH3 domain
11	PF17902 SH3_10	0.00022	32.5	SH3 domain
12	PF07653 SH3_2	0.049	24.7	Variant SH3 domain
13	PF08239 SH3_3	5.2	18.9	Bacterial SH3 domain
14	PF06347 SH3_4	1.1e+02	14.0	Bacterial SH3 domain
15	PF14604 SH3_9	4.6e-07	41.0	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398655

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000046794	0.999	Lymphocyte cytosolic protein 2
2	9606.ENSP00000472929	0.996	Proto-oncogene vav
3	9606.ENSP00000354566	0.991	T-cell surface glycoprotein CD3 epsilon chain
4	9606.ENSP00000324890	0.988	T-cell-specific surface glycoprotein CD28
5	9606.ENSP00000011653	0.987	T-cell surface glycoprotein CD4
6	9606.ENSP00000354782	0.986	T-cell surface glycoprotein CD3 zeta chain
7	9606.ENSP00000378845	0.984	Linker for activation of T cells
8	9606.ENSP00000264033	0.978	E3 ubiquitin-protein ligase CBL
9	9606.ENSP00000300692	0.977	T-cell surface glycoprotein CD3 delta chain
10	9606.ENSP00000264972	0.975	Tyrosine-protein kinase ZAP-70
11	9606.ENSP00000244007	0.972	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
12	9606.ENSP00000339186	0.969	GRB2-related adapter protein 2
13	9606.ENSP00000431445	0.968	T-cell surface glycoprotein CD3 gamma chain
14	9606.ENSP00000376345	0.965	Growth factor receptor-bound protein 2
15	9606.ENSP00000224337	0.961	B-cell linker protein
16	9606.ENSP00000337825	0.955	Tyrosine-protein kinase Lck
17	9606.ENSP00000346671	0.955	Tyrosine-protein kinase Fyn
18	9606.ENSP00000313829	0.943	KH domain-containing, RNA-binding, signal transduction-associated protein 1
19	9606.ENSP00000482457	0.943	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
20	9606.ENSP00000303939	0.940	Cytotoxic T-lymphocyte protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0004715	0.737	non-membrane spanning protein tyrosine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.994	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0023052	0.984	signaling
GO:0007154	0.982	cell communication
GO:0002376	0.975	immune system process
GO:0001775	0.966	cell activation
GO:0048518	0.940	positive regulation of biological process
GO:0051716	0.932	cellular response to stimulus
GO:0045321	0.923	leukocyte activation
GO:0007165	0.872	signal transduction
GO:0046649	0.862	lymphocyte activation
GO:0042110	0.805	T cell activation
GO:0048583	0.762	regulation of response to stimulus
GO:0019222	0.759	regulation of metabolic process
GO:0060255	0.702	regulation of macromolecule metabolic process
GO:0048522	0.666	positive regulation of cellular process
GO:0008152	0.600	metabolic process
GO:0048856	0.578	anatomical structure development
GO:0002682	0.570	regulation of immune system process
GO:0007166	0.565	cell surface receptor signaling pathway
GO:0006950	0.561	response to stress
GO:0002684	0.552	positive regulation of immune system process
GO:0071704	0.507	organic substance metabolic process
GO:0050776	0.500	regulation of immune response
GO:0048584	0.496	positive regulation of response to stimulus
GO:0044237	0.475	cellular metabolic process
GO:0009893	0.475	positive regulation of metabolic process
GO:0010468	0.474	regulation of gene expression
GO:0010604	0.465	positive regulation of macromolecule metabolic process
GO:0051239	0.459	regulation of multicellular organismal process
GO:0050778	0.456	positive regulation of immune response
GO:0044238	0.417	primary metabolic process
GO:0065009	0.411	regulation of molecular function
GO:0051240	0.403	positive regulation of multicellular organismal process
GO:0006807	0.385	nitrogen compound metabolic process
GO:0002768	0.360	immune response-regulating cell surface receptor signaling pathway
GO:0043170	0.356	macromolecule metabolic process
GO:0002429	0.348	immune response-activating cell surface receptor signaling pathway
GO:0051171	0.321	regulation of nitrogen compound metabolic process
GO:0031323	0.315	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.990	plasma membrane
GO:0043226	0.779	organelle
GO:0043227	0.767	membrane-bounded organelle
GO:0043231	0.753	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.737	non-specific protein-tyrosine kinase.

[back to server]