StarFunc result for job id Q08999

User Input

>input (1139 residues)
MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAPPAESPTPQIQQRFDELCSRLNMDE
AARAEAWDSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRILKC
SEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEE
QPRQQRGRKQRRQPCTVSEIFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNA
LQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCIIEKLCSLHDGLVLEAKGIKEHFWKP
YIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDERIFLGEDAEE
EIGTLSRCLNAGSGTETAERVQMKNILQQHFDKSKALRISTPLTGVRYIKENSPCVTPVS
TATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDF
SNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVV
TFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWK
PESPLWEKIRDNENRVPTCEEVMPPQNLERADEICIAGSPLTPRRVTEVRADTGGLGRSI
TSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPPQPLVNAVPVQNVSGETVSVT
PVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQPL
SAQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGQQQKQGQSVTSSSNRPRKTSSLSLFF
RKVYHLAAVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVMA
KVTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKDR
TSRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDMEEEERGDLIQFYNNIYIKQIKTF
AMKYSQANMDAPPLSPYPFVRTGSPRRIQLSQNHPVYISPHKNETMLSPREKIFYYFSNS
PSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQDVANDRGSH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08999	1.000	1.000	0.000	1139	1.000	1.000	Q08999.pdb.gz	RBL2_HUMAN Retinoblastoma-like protein 2 OS=Homo sapiens OX=9606 GN=RBL2 PE=1 SV=3
2	AFDB:P28749	0.680	0.723	1.994E-87	1068	0.491	0.523	P28749.pdb.gz	RBL1_HUMAN Retinoblastoma-like protein 1 OS=Homo sapiens OX=9606 GN=RBL1 PE=1 SV=3
3	AFDB:Q66WV0	0.500	0.561	2.190E-31	1003	0.206	0.234	Q66WV0.pdb.gz	RBR1_NICBE Retinoblastoma-related protein 1 OS=Nicotiana benthamiana OX=4100 GN=RBR1 PE=2 SV=1
4	AFDB:Q68EM7	0.070	0.084	8.471E-4	881	0.127	0.165	Q68EM7.pdb.gz	RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17 PE=1 SV=1
5	AFDB:Q5B1Q9	0.076	0.089	1.306E-3	891	0.123	0.157	Q5B1Q9.pdb.gz	Q5B1Q9_EMENI Dis1/XMAP215 protein AlpA (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=alpA PE=4 SV=1
6	AFDB:Q961B0	0.076	0.079	1.694E-3	1067	0.103	0.110	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
7	AFDB:Q9VAS9	0.075	0.048	2.104E-3	2417	0.130	0.061	Q9VAS9.pdb.gz	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
8	AFDB:F4IAT2	0.079	0.066	2.197E-3	1823	0.112	0.070	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
9	AFDB:Q7TPV4	0.094	0.084	8.062E-3	1344	0.089	0.075	Q7TPV4.pdb.gz	MBB1A_MOUSE Myb-binding protein 1A OS=Mus musculus OX=10090 GN=Mybbp1a PE=1 SV=2
10	AFDB:A0A0G2K8V3	0.077	0.062	8.792E-3	1613	0.116	0.082	A0A0G2K8V3.pdb.gz	A0A0G2K8V3_RAT THO complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Thoc2 PE=1 SV=2
11	PDB:7zs9M	0.093	0.264	1.556E-1	310	0.030	0.110	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
12	PDB:7bc7A	0.065	0.129	2.506E-1	432	0.040	0.106	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
13	PDB:1g3nC	0.075	0.298	2.617E-1	233	0.026	0.129	1g3nC.pdb.gz
14	PDB:3m62A	0.072	0.083	3.702E-1	955	0.068	0.081	3m62A.pdb.gz
15	PDB:7o4i1	0.051	0.092	4.037E-1	522	0.050	0.109	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
16	PDB:4v1nM	0.079	0.253	5.467E-1	299	0.032	0.120	4v1nM.pdb.gz	Architecture of the RNA Polymerase II-Mediator Core Initiation Complex.
17	PDB:5l9tA	0.084	0.077	5.962E-1	1380	0.076	0.062	5l9tA.pdb.gz
18	PDB:5k3iA	0.056	0.074	7.091E-1	661	0.049	0.085	5k3iA.pdb.gz	Structural characterization of acyl-CoA oxidases reveals a direct link between pheromone biosynthesis and metabolic state in Caenorhabditis elegans.
19	PDB:5y50A	0.084	0.153	7.091E-1	448	0.045	0.114	5y50A.pdb.gz
20	PDB:1z3hB	0.077	0.089	7.405E-1	914	0.078	0.097	1z3hB.pdb.gz	The structure of the nuclear export receptor cse1 in its cytosolic state reveals a closed conformation incompatible with cargo binding

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O55081	0.0	2064	1135	0.884	0.887	RBL2_RAT Retinoblastoma-like protein 2 OS=Rattus norvegicus OX=10116 GN=Rbl2 PE=1 SV=1
2	P28749	0.0	1099	1068	0.492	0.524	RBL1_HUMAN Retinoblastoma-like protein 1 OS=Homo sapiens OX=9606 GN=RBL1 PE=1 SV=3
3	Q08999	0.0	2373	1139	1.000	1.000	RBL2_HUMAN Retinoblastoma-like protein 2 OS=Homo sapiens OX=9606 GN=RBL2 PE=1 SV=3
4	Q64700	0.0	2077	1135	0.888	0.891	RBL2_MOUSE Retinoblastoma-like protein 2 OS=Mus musculus OX=10090 GN=Rbl2 PE=1 SV=3
5	Q64701	0.0	1063	1063	0.486	0.520	RBL1_MOUSE Retinoblastoma-like protein 1 OS=Mus musculus OX=10090 GN=Rbl1 PE=1 SV=3
6	Q24472	4.09e-81	285	845	0.158	0.213	RBF_DROME Retinoblastoma family protein OS=Drosophila melanogaster OX=7227 GN=Rbf PE=1 SV=2
7	H0YE05	5.50e-70	236	254	0.100	0.449	H0YE05_HUMAN RB transcriptional corepressor like 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBL1 PE=1 SV=8
8	Q9YGE5	1.26e-48	190	910	0.144	0.180	Q9YGE5_ONCMY Retinoblastoma 1 OS=Oncorhynchus mykiss OX=8022 GN=RB1 PE=2 SV=1
9	A0JMQ4	2.04e-48	189	903	0.141	0.178	A0JMQ4_DANRE Retinoblastoma 1 OS=Danio rerio OX=7955 GN=zgc:154147 PE=1 SV=1
10	P06400	1.23e-46	184	928	0.147	0.180	RB_HUMAN Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2
11	A0A0D9RYS3	2.02e-46	183	928	0.146	0.179	A0A0D9RYS3_CHLSB RB transcriptional corepressor 1 OS=Chlorocebus sabaeus OX=60711 GN=RB1 PE=3 SV=1
12	P13405	6.85e-44	175	921	0.146	0.180	RB_MOUSE Retinoblastoma-associated protein OS=Mus musculus OX=10090 GN=Rb1 PE=1 SV=2
13	P33568	8.35e-44	175	920	0.131	0.162	RB_RAT Retinoblastoma-associated protein OS=Rattus norvegicus OX=10116 GN=Rb1 PE=1 SV=3
14	G5EDT1	3.45e-35	147	961	0.137	0.162	LIN35_CAEEL Retinoblastoma-like protein homolog lin-35 OS=Caenorhabditis elegans OX=6239 GN=lin-35 PE=1 SV=1
15	Q66WV0	9.82e-30	130	1003	0.133	0.152	RBR1_NICBE Retinoblastoma-related protein 1 OS=Nicotiana benthamiana OX=4100 GN=RBR1 PE=2 SV=1
16	Q9LKZ3	1.49e-27	123	1013	0.133	0.150	RBR1_ARATH Retinoblastoma-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=RBR1 PE=1 SV=1
17	Q9VF04	1.83e-27	122	783	0.127	0.185	Q9VF04_DROME RE32990p OS=Drosophila melanogaster OX=7227 GN=Rbf2 PE=2 SV=1
18	Q9NIS1	2.61e-19	96.3	782	0.066	0.096	Q9NIS1_DROME RB-related protein RBF2 OS=Drosophila melanogaster OX=7227 GN=Rbf2 PE=3 SV=1
19	Q54FX2	1.54e-11	71.6	1312	0.031	0.027	RBLA_DICDI Retinoblastoma-like protein A OS=Dictyostelium discoideum OX=44689 GN=rblA PE=2 SV=1
20	Q7Z5P9	0.045	40.8	8384	0.048	0.007	MUC19_HUMAN Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11934 DUF3452	1.8e-44	162.1	Domain of unknown function (DUF3452)
2	PF01858 RB_A	3.5e-71	250.7	Retinoblastoma-associated protein A domain
3	PF01857 RB_B	2.9e-57	203.7	Retinoblastoma-associated protein B domain
4	PF00395 SLH	2.8e+02	12.9	S-layer homology domain
5	PF00382 TFIIB	0.59	21.5	Transcription factor TFIIB repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262133

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.999	Histone deacetylase 1
2	9606.ENSP00000368686	0.999	Transcription factor E2F4
3	9606.ENSP00000398124	0.996	Transcription factor E2F5
4	9606.ENSP00000266970	0.994	Cyclin-dependent kinase 2
5	9606.ENSP00000261254	0.992	G1/S-specific cyclin-D2
6	9606.ENSP00000362082	0.992	G1/S-specific cyclin-D3
7	9606.ENSP00000345571	0.988	Transcription factor E2F1
8	9606.ENSP00000262643	0.981	G1/S-specific cyclin-E1
9	9606.ENSP00000274026	0.979	Cyclin-A2
10	9606.ENSP00000329102	0.978	Protein lin-9 homolog
11	9606.ENSP00000341947	0.977	Protein lin-54 homolog
12	9606.ENSP00000257904	0.974	Cyclin-dependent kinase 4
13	9606.ENSP00000418447	0.973	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
14	9606.ENSP00000227507	0.972	G1/S-specific cyclin-D1
15	9606.ENSP00000265734	0.971	Cyclin-dependent kinase 6
16	9606.ENSP00000384849	0.966	Cyclin-dependent kinase inhibitor 1
17	9606.ENSP00000364519	0.963	Transcription factor Dp-1
18	9606.ENSP00000451812	0.961	Protein lin-52 homolog
19	9606.ENSP00000262904	0.960	Transcription factor E2F3
20	9606.ENSP00000362768	0.960	Retinoblastoma-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990841	0.975	promoter-specific chromatin binding
GO:1901363	0.457	heterocyclic compound binding
GO:0097159	0.456	organic cyclic compound binding
GO:0003676	0.449	nucleic acid binding
GO:0003677	0.422	DNA binding
GO:0008134	0.365	transcription factor binding
GO:0003690	0.342	double-stranded DNA binding
GO:1990837	0.313	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0019222	0.993	regulation of metabolic process
GO:0031323	0.984	regulation of cellular metabolic process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0048519	0.970	negative regulation of biological process
GO:0010468	0.962	regulation of gene expression
GO:0010605	0.956	negative regulation of macromolecule metabolic process
GO:0065009	0.917	regulation of molecular function
GO:0051174	0.870	regulation of phosphorus metabolic process
GO:0043549	0.799	regulation of kinase activity
GO:0080090	0.779	regulation of primary metabolic process
GO:0051171	0.767	regulation of nitrogen compound metabolic process
GO:0048523	0.708	negative regulation of cellular process
GO:0009987	0.660	cellular process
GO:0043550	0.610	regulation of lipid kinase activity
GO:0019219	0.530	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.511	regulation of macromolecule biosynthetic process
GO:0031326	0.511	regulation of cellular biosynthetic process
GO:0010629	0.506	negative regulation of gene expression
GO:0031324	0.455	negative regulation of cellular metabolic process
GO:0006355	0.437	regulation of DNA-templated transcription
GO:0006357	0.399	regulation of transcription by RNA polymerase II
GO:0008152	0.343	metabolic process
GO:0051172	0.343	negative regulation of nitrogen compound metabolic process
GO:0048518	0.320	positive regulation of biological process
GO:0050896	0.319	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0032991	0.975	protein-containing complex
GO:0005829	0.945	cytosol
GO:0005694	0.881	chromosome
GO:0005730	0.317	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]