StarFunc result for job id Q08AD1

User Input

>input (1489 residues)
MGDAADPREMRKTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELQEPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAQKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKVIACAQQYSAFFQATDLPYDIEDA
VMYWINKVNEHLKDIMEQEQKLKEHHTVEAPGGQKSPSKWFWKLVPARYRKEQTLLKQLP
CIPLVENLLKDGTDGCALAALIHFYCPDVVRLEDICLKETMSLADSLYNLQLIQEFCQEY
LNQCCHFTLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVVRPQGAEPVKDMPS
IPVLNAAKRNVLDSSSDFPSSGEGATFTQSHHHLPSRYSRPQAHSSASGGIRRSSSMSYV
DGFIGTWPKEKRSSVHGVSFDISFDKEDSVQRSTPNRGITRSISNEGLTLNNSHVSKHIR
KNLSFKPINGEEEAESIEEELNIDSHSDLKSCVPLNTNELNSNENIHYKLPNGALQNRIL
LDEFGNQIETPSIEEALQIIHDTEKSPHTPQPDQIANGFFLHSQEMSILNSNIKLNQSSP
DNVTDTKGALSPITDNTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFLQD
YDIRTGNTREALSPCPSTVSTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSGSSS
QKTTPEGSELNIPHVVAWAQIPEETGLPQGRDTTQLLASEMVHLRMKLEEKRRAIEAQKK
KMEAAFTKQRQKMGRTAFLTVVKKKGDGISPLREEAAGAEDEKVYTDRAKEKESQKTDGQ
RSKSLADIKESMENPQAKWLKSPTTPIDPEKQWNLASPSEETLNEGEILEYTKSIEKLNS
SLHFLQQEMQRLSLQQEMLMQMREQQSWVISPPQPSPQKQIRDFKPSKQAGLSSAIAPFS
SDSPRPTHPSPQSSNRKSASFSVKSQRTPRPNELKITPLNRTLTPPRSVDSLPRLRRFSP
SQVPIQTRSFVCFGDDGEPQLKESKPKEEVKKEELESKGTLEQRGHNPEEKEIKPFESTV
SEVLSLPVTETVCLTPNEDQLNQPTEPPPKPVFPPTAPKNVNLIEVSLSDLKPPEKADVP
VEKYDGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQL
EAEMEHKKEETRRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQVVK
QKKQRPKSIHRDHIESPKTPIKGPPVSSLSLASLNTGDNESVHSGKRTPRSESVEGFLSP
SRCGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNE
GQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEG
LYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08AD1	1.000	1.000	0.000	1489	1.000	1.000	Q08AD1.pdb.gz	CAMP2_HUMAN Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3
2	AFDB:Q8C1B1	0.343	0.348	0.000	1461	0.916	0.934	Q8C1B1.pdb.gz	CAMP2_MOUSE Calmodulin-regulated spectrin-associated protein 2 OS=Mus musculus OX=10090 GN=Camsap2 PE=1 SV=3
3	AFDB:D3Z8E6	0.226	0.210	4.821E-81	1604	0.416	0.387	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
4	AFDB:Q5T5Y3	0.266	0.248	5.353E-81	1602	0.416	0.387	Q5T5Y3.pdb.gz	CAMP1_HUMAN Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1 PE=1 SV=2
5	AFDB:A1ZAU8	0.183	0.168	1.093E-42	1630	0.236	0.215	A1ZAU8.pdb.gz	PTRO_DROME Patronin OS=Drosophila melanogaster OX=7227 GN=Patronin PE=1 SV=1
6	AFDB:Q8C5W0	0.116	0.158	1.718E-4	1052	0.094	0.133	Q8C5W0.pdb.gz	CLMN_MOUSE Calmin OS=Mus musculus OX=10090 GN=Clmn PE=1 SV=2
7	AFDB:Q7YSI9	0.053	0.048	3.579E-4	1654	0.116	0.105	Q7YSI9.pdb.gz	UNC53_CAEEL Adapter protein unc-53 OS=Caenorhabditis elegans OX=6239 GN=unc-53 PE=1 SV=1
8	PDB:7sx8D	0.057	0.173	4.736E-2	448	0.032	0.107	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
9	AFDB:E9QHX3	0.055	0.061	5.203E-2	1246	0.097	0.116	E9QHX3.pdb.gz
10	AFDB:O43019	0.035	0.060	6.417E-2	793	0.084	0.158	O43019.pdb.gz	SRE2_SCHPO Putative transcription factor sre2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sre2 PE=1 SV=1
11	AFDB:Q8IVL0	0.067	0.045	7.913E-2	2385	0.105	0.065	Q8IVL0.pdb.gz	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3
12	PDB:7r5jK0	0.054	0.067	2.966E-1	1086	0.034	0.046	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	PDB:6ahd1	0.046	0.059	4.511E-1	1048	0.028	0.039	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
14	PDB:5x9uA	0.038	0.089	4.754E-1	494	0.015	0.045	5x9uA.pdb.gz	Structural and mechanistic characterization of an archaeal-like chaperonin from a thermophilic bacterium
15	PDB:6h8qA	0.047	0.069	5.009E-1	879	0.028	0.048	6h8qA.pdb.gz	Structural basis for Scc3-dependent cohesin recruitment to chromatin.
16	PDB:5iplD	0.038	0.043	8.916E-1	1173	0.019	0.024	5iplD.pdb.gz	Structures of E. coli sigma S-transcription initiation complexes provide new insights into polymerase mechanism.
17	PDB:4xciA	0.059	0.164	9.901E-1	313	0.028	0.134	4xciA.pdb.gz
18	PDB:5gjqP	0.035	0.078	9.901E-1	413	0.015	0.056	5gjqP.pdb.gz	An atomic structure of the human 26S proteasome.
19	PDB:6x15A	0.050	0.132	1.100	419	0.028	0.098	6x15A.pdb.gz	Large domain movements through the lipid bilayer mediate substrate release and inhibition of glutamate transporters.
20	PDB:7wooF	0.042	0.040	1.159	1622	0.034	0.031	7wooF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4AEC2	0.0	2746	1470	0.924	0.936	CAMP2_RAT Calmodulin-regulated spectrin-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Camsap2 PE=1 SV=1
2	Q08AD1	0.0	3088	1489	1.000	1.000	CAMP2_HUMAN Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3
3	Q8C1B1	0.0	2701	1461	0.915	0.932	CAMP2_MOUSE Calmodulin-regulated spectrin-associated protein 2 OS=Mus musculus OX=10090 GN=Camsap2 PE=1 SV=3
4	Q5T5Y3	3.50e-141	475	1602	0.248	0.230	CAMP1_HUMAN Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1 PE=1 SV=2
5	D3Z8E6	5.88e-124	426	1604	0.160	0.148	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
6	Q80VC9	7.93e-91	325	1252	0.129	0.153	CAMP3_MOUSE Calmodulin-regulated spectrin-associated protein 3 OS=Mus musculus OX=10090 GN=Camsap3 PE=1 SV=1
7	Q9P1Y5	1.09e-88	318	1249	0.129	0.154	CAMP3_HUMAN Calmodulin-regulated spectrin-associated protein 3 OS=Homo sapiens OX=9606 GN=CAMSAP3 PE=1 SV=2
8	U4PAZ9	3.77e-38	158	1112	0.073	0.098	PTRN1_CAEEL Patronin (microtubule-binding protein) homolog OS=Caenorhabditis elegans OX=6239 GN=ptrn-1 PE=1 SV=1
9	A1ZAU8	1.41e-33	144	1630	0.064	0.059	PTRO_DROME Patronin OS=Drosophila melanogaster OX=7227 GN=Patronin PE=1 SV=1
10	Q8IDX6	0.23	38.5	3130	0.021	0.010	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
11	B2ZX90	0.52	37.4	940	0.016	0.026	FAS1_ORYSJ Chromatin assembly factor 1 subunit FSM OS=Oryza sativa subsp. japonica OX=39947 GN=FSM PE=2 SV=1
12	Q1MTN9	0.90	36.6	544	0.018	0.050	RLF2_SCHPO Chromatin assembly factor 1 subunit rlf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rlf2 PE=1 SV=2
13	Q9QZQ1	1.8	35.8	1820	0.018	0.015	AFAD_MOUSE Afadin OS=Mus musculus OX=10090 GN=Afdn PE=1 SV=3
14	Q586J3	2.0	35.4	978	0.033	0.050	Q586J3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=25N14.220 PE=4 SV=1
15	E7EY87	2.2	35.0	693	0.025	0.053	E7EY87_DANRE UV radiation resistance-associated gene OS=Danio rerio OX=7955 GN=Uvrag1 PE=1 SV=1
16	Q61789	2.5	35.4	3330	0.021	0.009	LAMA3_MOUSE Laminin subunit alpha-3 OS=Mus musculus OX=10090 GN=Lama3 PE=1 SV=4
17	P33332	2.7	35.0	1336	0.020	0.022	SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC3 PE=1 SV=1
18	Q75JH9	2.7	35.0	1503	0.015	0.015	Q75JH9_DICDI Actin binding protein OS=Dictyostelium discoideum OX=44689 GN=enlA PE=4 SV=1
19	O35889	6.3	33.9	1829	0.017	0.014	AFAD_RAT Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 SV=1
20	O42631	6.7	33.5	590	0.015	0.037	MUB1_EMENI MYND-type zinc finger protein samB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=samB PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17095 CAMSAP_CC1	2.2e-20	83.6	Spectrin-binding region of Ca2+-Calmodulin
2	PF11971 CAMSAP_CH	2.7e-33	124.9	CAMSAP CH domain
3	PF08683 CAMSAP_CKK	4e-53	190.0	Microtubule-binding calmodulin-regulated spectrin-associated
4	PF00307 CH	1.7e+02	13.8	Calponin homology (CH) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000236925

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368982	0.781	Katanin p80 WD40 repeat-containing subunit B1
2	9606.ENSP00000295148	0.726	WD repeat and coiled-coil-containing protein
3	9606.ENSP00000307959	0.701	Dystonin
4	9606.ENSP00000432279	0.694	Charged multivesicular body protein 1b
5	9606.ENSP00000354573	0.667	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5
6	9606.ENSP00000233121	0.640	Microtubule-associated protein RP/EB family member 3
7	9606.ENSP00000340975	0.640	Ankyrin repeat domain-containing protein SOWAHD
8	9606.ENSP00000368976	0.616	Kinesin-like protein KIFC3
9	9606.ENSP00000356375	0.607	Zinc finger and BTB domain-containing protein 41
10	9606.ENSP00000337641	0.602	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform
11	9606.ENSP00000416797	0.594	Calmodulin-regulated spectrin-associated protein 3
12	9606.ENSP00000253669	0.580	HAUS augmin-like complex subunit 8
13	9606.ENSP00000260383	0.575	Gamma-tubulin complex component 4
14	9606.ENSP00000358363	0.573	Myomegalin
15	9606.ENSP00000364721	0.573	Microtubule-associated protein RP/EB family member 1
16	9606.ENSP00000264712	0.569	Kinesin-like protein KIF3C
17	9606.ENSP00000295049	0.567	Raftlin-2
18	9606.ENSP00000480316	0.566	Gamma-tubulin complex component 5
19	9606.ENSP00000310788	0.561	Olfactory receptor 5J2
20	9606.ENSP00000274787	0.554	HIG1 domain family member 2A, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051011	1.000	microtubule minus-end binding
GO:0044877	0.307	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.997	cellular component organization
GO:0050794	0.995	regulation of cellular process
GO:0048856	0.976	anatomical structure development
GO:0032501	0.975	multicellular organismal process
GO:0051128	0.973	regulation of cellular component organization
GO:0030030	0.969	cell projection organization
GO:0048699	0.969	generation of neurons
GO:0032886	0.905	regulation of microtubule-based process
GO:0070507	0.886	regulation of microtubule cytoskeleton organization
GO:0031110	0.850	regulation of microtubule polymerization or depolymerization
GO:0000226	0.798	microtubule cytoskeleton organization
GO:0031344	0.783	regulation of cell projection organization
GO:0048666	0.774	neuron development
GO:0120036	0.770	plasma membrane bounded cell projection organization
GO:0044087	0.766	regulation of cellular component biogenesis
GO:0031175	0.703	neuron projection development
GO:0050793	0.664	regulation of developmental process
GO:0120035	0.630	regulation of plasma membrane bounded cell projection organization
GO:0050773	0.592	regulation of dendrite development
GO:1902903	0.565	regulation of supramolecular fiber organization
GO:0032271	0.538	regulation of protein polymerization
GO:0061564	0.477	axon development
GO:0031113	0.435	regulation of microtubule polymerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005815	1.000	microtubule organizing center
GO:1990752	1.000	microtubule end
GO:0012505	0.996	endomembrane system
GO:0005829	0.991	cytosol
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0005813	0.896	centrosome
GO:0016020	0.876	membrane
GO:0036449	0.785	microtubule minus-end
GO:0005794	0.723	Golgi apparatus
GO:0120025	0.545	plasma membrane bounded cell projection
GO:0070013	0.467	intracellular organelle lumen
GO:0031981	0.450	nuclear lumen
GO:0005929	0.404	cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]