StarFunc result for job id Q08AE8

User Input

>input (756 residues)
MAQAAGPAGGGEPRTEAVGGEGPREPGAAGGAAGGSRDALSLEEILRLYNQPINEEQAWA
VCYQCCGSLRAAARRRQPRHRVRSAAQIRVWRDGAVTLAPAADDAGEPPPVAGKLGYSQC
METEVIESLGIIIYKALDYGLKENEERELSPPLEQLIDHMANTVEADGSNDEGYEAAEEG
LGDEDEKRKISAIRSYRDVMKLCAAHLPTESDAPNHYQAVCRALFAETMELHTFLTKIKS
AKENLKKIQEMEKSDESSTDLEELKNADWARFWVQVMRDLRNGVKLKKVQERQYNPLPIE
YQLTPYEMLMDDIRCKRYTLRKVMVNGDIPPRLKKSAHEIILDFIRSRPPLNPVSARKLK
PTPPRPRSLHERILEEIKAERKLRPVSPEEIRRSRLAMRPLSMSYSFDLSDVTTPESTKN
LVESSMVNGGLTSQTKENGLSTSQQVPAQRKKLLRAPTLAELDSSESEEETLHKSTSSSS
VSPSFPEEPVLEAVSTRKKPPKFLPISSTPQPERRQPPQRRHSIEKETPTNVRQFLPPSR
QSSRSLEEFCYPVECLALTVEEVMHIRQVLVKAELEKYQQYKDIYTALKKGKLCFCCRTR
RFSFFTWSYTCQFCKRPVCSQCCKKMRLPSKPYSTLPIFSLGPSALQRGESSMRSEKPST
AHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSL
VLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08AE8	1.000	1.000	0.000	756	1.000	1.000	Q08AE8.pdb.gz	SPIR1_HUMAN Protein spire homolog 1 OS=Homo sapiens OX=9606 GN=SPIRE1 PE=1 SV=3
2	AFDB:D3YTL8	0.233	0.270	1.434E-65	643	0.714	0.840	D3YTL8.pdb.gz	D3YTL8_MOUSE Spire type actin nucleation factor 1 OS=Mus musculus OX=10090 GN=Spire1 PE=1 SV=1
3	AFDB:Q60700	0.131	0.113	3.506E-3	888	0.135	0.115	Q60700.pdb.gz	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1
4	PDB:8a8mB	0.115	0.274	2.827E-2	298	0.030	0.077	8a8mB.pdb.gz	Architecture of the MKK6-p38 alpha complex defines the basis of MAPK specificity and activation.
5	PDB:6s73A	0.126	0.319	4.853E-2	269	0.038	0.108	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
6	AFDB:Q95UN8	0.117	0.080	8.976E-2	1161	0.138	0.090	Q95UN8.pdb.gz	M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=slpr PE=1 SV=1
7	PDB:6m7zE	0.118	0.289	9.283E-2	269	0.030	0.086	6m7zE.pdb.gz
8	AFDB:P34707	0.067	0.079	1.000E-1	623	0.112	0.136	P34707.pdb.gz	SKN1_CAEEL Protein skinhead-1 OS=Caenorhabditis elegans OX=6239 GN=skn-1 PE=1 SV=2
9	AFDB:Q9BZL4	0.055	0.053	1.114E-1	782	0.126	0.121	Q9BZL4.pdb.gz	PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens OX=9606 GN=PPP1R12C PE=1 SV=1
10	PDB:7ooxA	0.125	0.303	1.152E-1	285	0.028	0.074	7ooxA.pdb.gz	Crystal Structure-Guided Design of Bisubstrate Inhibitors and Photoluminescent Probes for Protein Kinases of the PIM Family.
11	AFDB:Q582N9	0.074	0.058	1.176E-1	1063	0.118	0.084	Q582N9.pdb.gz	Q582N9_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.740 PE=4 SV=1
12	AFDB:Q9W002	0.122	0.064	1.176E-1	1504	0.139	0.070	Q9W002.pdb.gz	Q9W002_DROME Misshapen, isoform A OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=3
13	PDB:4ek6A	0.123	0.307	1.430E-1	279	0.036	0.097	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
14	PDB:5eymA	0.114	0.276	1.776E-1	292	0.032	0.082	5eymA.pdb.gz	Pharmacological Profile of BI 847325, an Orally Bioavailable, ATP-Competitive Inhibitor of MEK and Aurora Kinases.
15	PDB:6hhgA	0.118	0.216	1.874E-1	386	0.021	0.041	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
16	PDB:5x3fB	0.119	0.233	1.978E-1	349	0.025	0.054	5x3fB.pdb.gz
17	PDB:4c0tA	0.112	0.247	2.088E-1	291	0.042	0.110	4c0tA.pdb.gz
18	AFDB:O08815	0.125	0.081	2.131E-1	1206	0.114	0.071	O08815.pdb.gz	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
19	PDB:3pvuA	0.121	0.147	2.327E-1	609	0.052	0.064	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
20	AFDB:M9PBJ7	0.136	0.090	2.374E-1	1213	0.106	0.066	M9PBJ7.pdb.gz	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YTL8	0.0	965	643	0.689	0.810	D3YTL8_MOUSE Spire type actin nucleation factor 1 OS=Mus musculus OX=10090 GN=Spire1 PE=1 SV=1
2	J3KNG6	0.0	1096	545	0.716	0.993	J3KNG6_HUMAN Spire type actin nucleation factor 1 OS=Homo sapiens OX=9606 GN=SPIRE1 PE=1 SV=1
3	Q08AE8	0.0	1553	756	1.000	1.000	SPIR1_HUMAN Protein spire homolog 1 OS=Homo sapiens OX=9606 GN=SPIRE1 PE=1 SV=3
4	Q52KF3	0.0	1087	598	0.733	0.926	SPIR1_MOUSE Protein spire homolog 1 OS=Mus musculus OX=10090 GN=Spire1 PE=1 SV=1
5	Q8K1S6	7.75e-160	482	718	0.411	0.433	SPIR2_MOUSE Protein spire homolog 2 OS=Mus musculus OX=10090 GN=Spire2 PE=1 SV=1
6	Q8WWL2	8.80e-160	481	714	0.407	0.431	SPIR2_HUMAN Protein spire homolog 2 OS=Homo sapiens OX=9606 GN=SPIRE2 PE=1 SV=3
7	Q9U1K1	2.70e-58	216	1020	0.159	0.118	SPIR_DROME Protein spire OS=Drosophila melanogaster OX=7227 GN=spir PE=1 SV=1
8	Q0KK55	0.003	43.9	1742	0.045	0.020	KNDC1_MOUSE Kinase non-catalytic C-lobe domain-containing protein 1 OS=Mus musculus OX=10090 GN=Kndc1 PE=1 SV=2
9	O96838	0.045	39.7	1809	0.028	0.012	FYV1_DROME Putative 1-phosphatidylinositol 3-phosphate 5-kinase OS=Drosophila melanogaster OX=7227 GN=fab1 PE=1 SV=2
10	Q38AR4	1.7	33.1	148	0.017	0.088	Q38AR4_TRYB2 FYVE-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3760 PE=4 SV=1
11	Q64512	1.8	34.7	2453	0.058	0.018	PTN13_MOUSE Tyrosine-protein phosphatase non-receptor type 13 OS=Mus musculus OX=10090 GN=Ptpn13 PE=1 SV=2
12	Q6EHH9	2.3	34.3	2500	0.044	0.013	Q6EHH9_XENLA Frizzled-8 associated multidomain protein (Fragment) OS=Xenopus laevis OX=8355 GN=FRIED PE=1 SV=1
13	Q12923	3.5	33.9	2485	0.058	0.018	PTN13_HUMAN Tyrosine-protein phosphatase non-receptor type 13 OS=Homo sapiens OX=9606 GN=PTPN13 PE=1 SV=2
14	A9XP97	5.0	33.1	851	0.040	0.035	A9XP97_DANRE Sodium/hydrogen exchanger OS=Danio rerio OX=7955 GN=NHE3b PE=2 SV=1
15	O76902	5.9	32.3	316	0.028	0.066	PKHF1_DROME Pleckstrin homology domain-containing family F member 1 homolog OS=Drosophila melanogaster OX=7227 GN=rush PE=1 SV=1
16	Q389L9	6.3	30.8	118	0.030	0.195	Q389L9_TRYB2 FYVE-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0825 PE=4 SV=1
17	Q9Y4F1	6.8	32.7	1045	0.026	0.019	FARP1_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1 PE=1 SV=1
18	Q3UTY6	8.2	32.3	1018	0.026	0.020	THSD4_MOUSE Thrombospondin type-1 domain-containing protein 4 OS=Mus musculus OX=10090 GN=Thsd4 PE=1 SV=2
19	F1LYQ8	8.6	32.3	1049	0.026	0.019	FARP1_RAT FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Farp1 PE=1 SV=2
20	Q66JT5	9.0	32.0	296	0.041	0.105	TPGS2_MOUSE Tubulin polyglutamylase complex subunit 2 OS=Mus musculus OX=10090 GN=Tpgs2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01363 FYVE	8.5e+02	11.5	FYVE zinc finger
2	PF16474 KIND	1.2e-78	274.9	Kinase non-catalytic C-lobe domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387266

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318884	0.989	Formin-2
2	9606.ENSP00000479134	0.897	Formin-1
3	9606.ENSP00000376410	0.734	Inverted formin-2
4	9606.ENSP00000270583	0.658	Kelch domain containing 4
5	9606.ENSP00000285039	0.639	Unconventional myosin-Vb
6	9606.ENSP00000378974	0.604	Mitogen-activated protein kinase 8
7	9606.ENSP00000303208	0.601	Proprotein convertase subtilisin/kexin type 9
8	9606.ENSP00000381876	0.594	Dishevelled associated activator of morphogenesis 2
9	9606.ENSP00000281830	0.550	Potassium voltage-gated channel subfamily E member 4
10	9606.ENSP00000346032	0.539	Annexin A2
11	9606.ENSP00000378557	0.533	Disheveled-associated activator of morphogenesis 1
12	9606.ENSP00000262127	0.528	Centrosomal protein of 76 kDa
13	9606.ENSP00000329219	0.505	Formin-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0016043	0.955	cellular component organization
GO:0051640	0.950	organelle localization
GO:0022402	0.945	cell cycle process
GO:0048522	0.939	positive regulation of cellular process
GO:0051054	0.930	positive regulation of DNA metabolic process
GO:2001022	0.929	positive regulation of response to DNA damage stimulus
GO:0006282	0.928	regulation of DNA repair
GO:0045739	0.922	positive regulation of DNA repair
GO:0010821	0.901	regulation of mitochondrion organization
GO:0051130	0.891	positive regulation of cellular component organization
GO:0022607	0.889	cellular component assembly
GO:0030036	0.863	actin cytoskeleton organization
GO:0010638	0.856	positive regulation of organelle organization
GO:0007015	0.837	actin filament organization
GO:0051234	0.832	establishment of localization
GO:2000779	0.831	regulation of double-strand break repair
GO:2000781	0.824	positive regulation of double-strand break repair
GO:0051017	0.740	actin filament bundle assembly
GO:0051656	0.667	establishment of organelle localization
GO:0051649	0.667	establishment of localization in cell
GO:0051293	0.627	establishment of spindle localization
GO:0022414	0.487	reproductive process
GO:1903046	0.470	meiotic cell cycle process
GO:0022603	0.337	regulation of anatomical structure morphogenesis
GO:0006810	0.325	transport
GO:0010822	0.306	positive regulation of mitochondrion organization
GO:0090140	0.300	regulation of mitochondrial fission

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031090	0.999	organelle membrane
GO:0031981	0.995	nuclear lumen
GO:0005829	0.994	cytosol
GO:0005654	0.994	nucleoplasm
GO:0098588	0.950	bounding membrane of organelle
GO:0005739	0.877	mitochondrion
GO:0031975	0.780	envelope
GO:0031967	0.769	organelle envelope
GO:0071944	0.756	cell periphery
GO:0031982	0.729	vesicle
GO:0019867	0.726	outer membrane
GO:0005740	0.716	mitochondrial envelope
GO:0031966	0.713	mitochondrial membrane
GO:0031968	0.711	organelle outer membrane
GO:0012505	0.687	endomembrane system
GO:0005886	0.659	plasma membrane
GO:0031410	0.646	cytoplasmic vesicle
GO:0005741	0.471	mitochondrial outer membrane
GO:0043232	0.415	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]