StarFunc result for job id Q08AG5

User Input

>input (666 residues)
MDLVAFEDVAVNFTQEEWSLLDPSQKNLYREVMQETLRNLASIGEKWKDQNIEDQYKNPR
NNLRSLLGERVDENTEENHCGETSSQIPDDTLNKKTSPGVKSCESSVCGEVFVGHSSLNR
HIRADTAHKPSEYQEYGQEPYKCQQRKKAFRCHPSFQMQEKAHTGEKLYDCKECGKTFIS
HSSIQRHMIMHNGDGTYKCKFCGKACPCLSIYLIHERVHTGEKPYKCKQCGKAFSYSTSL
QIHERTHTGEKPYECKECGKAFGSPNSLYEHRRTHTGEKPYECKQCGKAFRWFHSFQIHE
RTHSEEKAYECTKCGKAFKCPSYLCRHEVTHSGKKPCECKQCGKALSYLNFQRHMKMHTR
MRPYKCKTVEKPLILPVRFEDMKELTLERNLMNASTVVKPSIVPVPFTIMKGLTLERNPM
NVSSVVKPSFLPLPFDIMKGLTLERNRMSVSNVGKPSDLPHTFKCMEGLTLKRNPMNVSS
VVKPSFFPLPFDIMKGLTLERNPMSVSNVGKPSHLPHTFKCMKGLTLESNCMNLNNVKKP
LDLSETFKFMKRHTLERNPIRNMEKHSTISLPFKYMQQCTEDRMPMNVKSVTKHSYLPRS
FEYMQEHTLERNPMNVRNAEKRSIIFLLCVYTKGCTLERNHINVRIVGKHSVCLVPFVDI
KGLTLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08AG5	1.000	1.000	0.000	666	1.000	1.000	Q08AG5.pdb.gz	ZN844_HUMAN Zinc finger protein 844 OS=Homo sapiens OX=9606 GN=ZNF844 PE=1 SV=1
2	AFDB:Q8N7K0	0.304	0.301	8.436E-34	673	0.389	0.385	Q8N7K0.pdb.gz	ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens OX=9606 GN=ZNF433 PE=1 SV=1
3	AFDB:Q0D2J5	0.313	0.491	8.260E-33	394	0.369	0.624	Q0D2J5.pdb.gz	ZN763_HUMAN Zinc finger protein 763 OS=Homo sapiens OX=9606 GN=ZNF763 PE=1 SV=2
4	AFDB:P17024	0.209	0.252	1.136E-31	532	0.357	0.447	P17024.pdb.gz	ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens OX=9606 GN=ZNF20 PE=1 SV=2
5	AFDB:Q8IYI8	0.292	0.325	1.010E-30	595	0.356	0.398	Q8IYI8.pdb.gz	ZN440_HUMAN Zinc finger protein 440 OS=Homo sapiens OX=9606 GN=ZNF440 PE=1 SV=1
6	AFDB:Q8NDP4	0.291	0.379	1.808E-30	499	0.357	0.477	Q8NDP4.pdb.gz	ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens OX=9606 GN=ZNF439 PE=1 SV=1
7	AFDB:Q9Y2A4	0.302	0.300	2.798E-30	671	0.335	0.332	Q9Y2A4.pdb.gz	ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens OX=9606 GN=ZNF443 PE=2 SV=2
8	AFDB:Q9ULM2	0.189	0.232	3.931E-30	529	0.309	0.389	Q9ULM2.pdb.gz	ZN490_HUMAN Zinc finger protein 490 OS=Homo sapiens OX=9606 GN=ZNF490 PE=1 SV=2
9	AFDB:Q8TBZ8	0.242	0.284	1.458E-29	553	0.329	0.396	Q8TBZ8.pdb.gz	ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens OX=9606 GN=ZNF564 PE=1 SV=1
10	AFDB:Q9UC07	0.311	0.361	2.048E-29	566	0.362	0.426	Q9UC07.pdb.gz	ZNF69_HUMAN Zinc finger protein 69 OS=Homo sapiens OX=9606 GN=ZNF69 PE=1 SV=2
11	PDB:3w5kB	0.076	0.247	8.488E-4	110	0.062	0.373	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:3t6qA	0.089	0.096	1.066	601	0.044	0.048	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
13	PDB:6gffI	0.120	0.135	1.175	551	0.068	0.082	6gffI.pdb.gz
14	PDB:5hynA	0.068	0.075	1.573	581	0.080	0.091	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
15	PDB:6g90T	0.045	0.060	2.555	462	0.051	0.074	6g90T.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
16	PDB:4kblA	0.049	0.069	2.956	395	0.054	0.091	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
17	PDB:2nspA	0.100	0.164	3.103	342	0.041	0.079	2nspA.pdb.gz	Molecular basis of the activity of the phytopathogen pectin methylesterase.
18	PDB:6ydhA	0.034	0.160	3.103	62	0.021	0.226	6ydhA.pdb.gz
19	PDB:4r8pL	0.044	0.095	3.419	254	0.026	0.067	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
20	PDB:6ff4t	0.036	0.108	3.589	172	0.039	0.151	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08AG5	0.0	1387	666	1.000	1.000	ZN844_HUMAN Zinc finger protein 844 OS=Homo sapiens OX=9606 GN=ZNF844 PE=1 SV=1
2	Q8IYI8	0.0	538	595	0.459	0.514	ZN440_HUMAN Zinc finger protein 440 OS=Homo sapiens OX=9606 GN=ZNF440 PE=1 SV=1
3	Q0D2J5	5.52e-175	505	394	0.372	0.629	ZN763_HUMAN Zinc finger protein 763 OS=Homo sapiens OX=9606 GN=ZNF763 PE=1 SV=2
4	Q8N7K0	5.95e-169	500	673	0.393	0.389	ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens OX=9606 GN=ZNF433 PE=1 SV=1
5	Q9UC07	6.57e-169	496	566	0.366	0.431	ZNF69_HUMAN Zinc finger protein 69 OS=Homo sapiens OX=9606 GN=ZNF69 PE=1 SV=2
6	P17024	2.35e-163	481	532	0.362	0.453	ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens OX=9606 GN=ZNF20 PE=1 SV=2
7	Q8NDP4	9.00e-160	471	499	0.360	0.481	ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens OX=9606 GN=ZNF439 PE=1 SV=1
8	Q7L945	5.28e-149	442	461	0.342	0.495	ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens OX=9606 GN=ZNF627 PE=1 SV=1
9	Q8TA94	1.94e-142	426	476	0.335	0.468	ZN563_HUMAN Zinc finger protein 563 OS=Homo sapiens OX=9606 GN=ZNF563 PE=1 SV=1
10	Q9Y2A4	7.50e-142	431	671	0.338	0.335	ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens OX=9606 GN=ZNF443 PE=2 SV=2
11	P52737	3.40e-139	419	540	0.345	0.426	ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens OX=9606 GN=ZNF136 PE=1 SV=1
12	Q8TBZ8	2.40e-137	415	553	0.318	0.383	ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens OX=9606 GN=ZNF564 PE=1 SV=1
13	Q3KP31	1.75e-131	401	576	0.309	0.358	ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens OX=9606 GN=ZNF791 PE=1 SV=1
14	Q9ULM2	2.17e-131	399	529	0.312	0.393	ZN490_HUMAN Zinc finger protein 490 OS=Homo sapiens OX=9606 GN=ZNF490 PE=1 SV=2
15	Q9BS34	1.19e-123	374	389	0.311	0.532	ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens OX=9606 GN=ZNF670 PE=1 SV=1
16	Q96I27	1.30e-123	371	306	0.290	0.631	ZN625_HUMAN Zinc finger protein 625 OS=Homo sapiens OX=9606 GN=ZNF625 PE=1 SV=1
17	Q96BR6	8.19e-122	372	464	0.290	0.416	ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens OX=9606 GN=ZNF669 PE=1 SV=2
18	Q8IZC7	8.74e-117	358	436	0.302	0.461	ZN101_HUMAN Zinc finger protein 101 OS=Homo sapiens OX=9606 GN=ZNF101 PE=1 SV=1
19	Q8N8L2	6.18e-116	356	437	0.273	0.416	ZN491_HUMAN Zinc finger protein 491 OS=Homo sapiens OX=9606 GN=ZNF491 PE=1 SV=1
20	Q8N8Z8	2.41e-114	360	693	0.314	0.302	ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens OX=9606 GN=ZNF441 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20481 DUF6721	83	14.9	Domain of unknown function (DUF6721)
2	PF01352 KRAB	1.9e-20	83.5	KRAB box
3	PF00096 zf-C2H2	3.3e-17	73.0	Zinc finger, C2H2 type
4	PF16622 zf-C2H2_11	44	15.3	zinc-finger C2H2-type
5	PF13894 zf-C2H2_4	3.8e-16	69.4	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	6.5e-08	43.6	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	1.2	20.7	Zinc-finger double-stranded RNA-binding
8	PF13465 zf-H2C2_2	1.3e-42	153.6	Zinc-finger double domain
9	PF09723 Zn-ribbon_8	1.8e+02	13.7	Zinc ribbon domain
10	PF17283 Zn_ribbon_SprT	17	16.8	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392024

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000389243	0.653	Zinc finger protein with KRAB and SCAN domains 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.921	cellular process
GO:0031326	0.833	regulation of cellular biosynthetic process
GO:0010556	0.832	regulation of macromolecule biosynthetic process
GO:0051252	0.832	regulation of RNA metabolic process
GO:0006355	0.819	regulation of DNA-templated transcription
GO:0048523	0.768	negative regulation of cellular process
GO:0010605	0.742	negative regulation of macromolecule metabolic process
GO:0051172	0.728	negative regulation of nitrogen compound metabolic process
GO:0031324	0.722	negative regulation of cellular metabolic process
GO:0045892	0.708	negative regulation of DNA-templated transcription
GO:0032501	0.615	multicellular organismal process
GO:0032502	0.603	developmental process
GO:0048856	0.541	anatomical structure development
GO:0071704	0.535	organic substance metabolic process
GO:0007275	0.526	multicellular organism development
GO:0048731	0.400	system development
GO:0006807	0.347	nitrogen compound metabolic process
GO:0043170	0.333	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0005654	0.974	nucleoplasm
GO:0005737	0.462	cytoplasm
GO:0032991	0.434	protein-containing complex
GO:0043232	0.334	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]