StarFunc result for job id Q08AH1

User Input

>input (577 residues)
MQWLMRFRTLWGIHKSFHNIHPAPSQLRCRSLSEFGAPRWNDYEVPEEFNFASYVLDYWA
QKEKEGKRGPNPAFWWVNGQGDEVKWSFREMGDLTRRVANVFTQTCGLQQGDHLALMLPR
VPEWWLVAVGCMRTGIIFIPATILLKAKDILYRLQLSKAKGIVTIDALASEVDSIASQCP
SLKTKLLVSDHSREGWLDFRSLVKSASPEHTCVKSKTLDPMVIFFTSGTTGFPKMAKHSH
GLALQPSFPGSRKLRSLKTSDVSWCLSDSGWIVATIWTLVEPWTAGCTVFIHHLPQFDTK
VIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG
LLLYENYGQSETGLICATYWGMKIKPGFMGKATPPYDVQVIDDKGSILPPNTEGNIGIRI
KPVRPVSLFMCYEGDPEKTAKVECGDFYNTGDRGKMDEEGYICFLGRSDDIINASGYRIG
PAEVESALVEHPAVAESAVVGSPDPIRGEVVKAFIVLTPQFLSHDKDQLTKELQQHVKSV
TAPYKYPRKVEFVSELPKTITGKIERKELRKKETGQM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08AH1	1.000	1.000	0.000	577	1.000	1.000	Q08AH1.pdb.gz	ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM1 PE=1 SV=1
2	AFDB:Q9BEA2	0.754	0.754	6.662E-102	577	0.761	0.761	Q9BEA2.pdb.gz	ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus OX=9913 GN=ACSM1 PE=1 SV=2
3	AFDB:Q91VA0	0.923	0.929	1.201E-101	573	0.697	0.702	Q91VA0.pdb.gz	ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus OX=10090 GN=Acsm1 PE=1 SV=1
4	AFDB:Q08AH3	0.905	0.905	2.636E-85	577	0.560	0.560	Q08AH3.pdb.gz	ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2A PE=1 SV=2
5	AFDB:Q3UNX5	0.917	0.913	1.023E-84	580	0.523	0.521	Q3UNX5.pdb.gz	ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus OX=10090 GN=Acsm3 PE=1 SV=2
6	PDB:3b7wA	0.899	0.965	7.941E-84	537	0.539	0.579	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
7	AFDB:Q53FZ2	0.750	0.739	1.149E-83	586	0.534	0.526	Q53FZ2.pdb.gz	ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM3 PE=1 SV=2
8	AFDB:Q8K0L3	0.909	0.913	3.320E-83	575	0.537	0.539	Q8K0L3.pdb.gz	ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus OX=10090 GN=Acsm2 PE=1 SV=1
9	AFDB:Q7TN78	0.752	0.749	3.727E-82	580	0.548	0.545	Q7TN78.pdb.gz	ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsm4 PE=1 SV=1
10	AFDB:Q729U8	0.715	0.747	1.634E-59	551	0.367	0.385	Q729U8.pdb.gz	Q729U8_DESVH AMP-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2250 PE=1 SV=1
11	AFDB:A4YDT1	0.688	0.703	2.151E-51	564	0.308	0.316	A4YDT1.pdb.gz	HBCL1_METS5 4-hydroxybutyrate--CoA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0406 PE=1 SV=1
12	PDB:2p20A	0.824	0.745	1.381E-45	641	0.253	0.228	2p20A.pdb.gz	Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.
13	PDB:1ry2A	0.670	0.631	8.553E-43	615	0.232	0.218	1ry2A.pdb.gz	Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP
14	PDB:6q2mA	0.654	0.691	5.296E-40	544	0.206	0.219	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
15	PDB:3r44A	0.633	0.722	1.624E-39	502	0.213	0.245	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
16	PDB:5ie2A	0.615	0.696	6.672E-38	506	0.196	0.223	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
17	PDB:1ultA	0.651	0.702	1.203E-37	533	0.206	0.223	1ultA.pdb.gz
18	PDB:5bsmA	0.650	0.704	1.929E-37	530	0.225	0.245	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
19	PDB:3rg2C	0.794	0.749	6.655E-37	613	0.196	0.184	3rg2C.pdb.gz	Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
20	PDB:7kydA	0.639	0.687	9.457E-36	534	0.217	0.234	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08AH1	0.0	1200	577	1.000	1.000	ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM1 PE=1 SV=1
2	Q08AH3	0.0	675	577	0.555	0.555	ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2A PE=1 SV=2
3	Q3UNX5	0.0	630	580	0.513	0.510	ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus OX=10090 GN=Acsm3 PE=1 SV=2
4	Q53FZ2	0.0	635	586	0.518	0.510	ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM3 PE=1 SV=2
5	Q68CK6	0.0	675	577	0.555	0.555	ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2B PE=1 SV=2
6	Q7TN78	0.0	642	580	0.548	0.545	ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsm4 PE=1 SV=1
7	Q80W40	0.0	640	580	0.546	0.543	ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus OX=10090 GN=Acsm4 PE=2 SV=1
8	Q8K0L3	0.0	657	575	0.536	0.537	ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus OX=10090 GN=Acsm2 PE=1 SV=1
9	Q91VA0	0.0	857	573	0.704	0.709	ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus OX=10090 GN=Acsm1 PE=1 SV=1
10	Q9BEA2	0.0	924	577	0.761	0.761	ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus OX=9913 GN=ACSM1 PE=1 SV=2
11	Q729U8	2.11e-122	374	551	0.367	0.385	Q729U8_DESVH AMP-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2250 PE=1 SV=1
12	A4YDT1	1.34e-84	276	564	0.312	0.319	HBCL1_METS5 4-hydroxybutyrate--CoA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0406 PE=1 SV=1
13	Q726Y7	2.79e-59	211	661	0.277	0.242	Q726Y7_DESVH Acetyl-coenzyme A synthetase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=acsA PE=1 SV=1
14	P9WQD1	1.05e-55	201	651	0.310	0.275	ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=acsA PE=1 SV=1
15	Q8ZKF6	1.78e-51	189	652	0.282	0.250	ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=acs PE=1 SV=1
16	Q99NB1	1.66e-50	187	682	0.277	0.235	ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus OX=10090 GN=Acss1 PE=1 SV=1
17	P27550	3.93e-50	185	652	0.277	0.245	ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) OX=83333 GN=acs PE=1 SV=2
18	Q9NUB1	5.21e-49	182	689	0.267	0.224	ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens OX=9606 GN=ACSS1 PE=1 SV=2
19	D3ZZN3	1.23e-48	181	682	0.269	0.227	D3ZZN3_RAT Acetyl-coenzyme A synthetase OS=Rattus norvegicus OX=10116 GN=Acss1 PE=3 SV=1
20	P69451	4.93e-47	175	561	0.263	0.271	LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) OX=83333 GN=fadD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	1.3e-66	236.7	AMP-binding enzyme
2	PF13193 AMP-binding_C	1.5e-21	88.5	AMP-binding enzyme C-terminal domain
3	PF08236 SRI	11	17.6	SRI (Set2 Rpb1 interacting) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301956

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377115	0.959	Lipoyltransferase 1, mitochondrial
2	9606.ENSP00000278840	0.915	Fatty acid desaturase 2
3	9606.ENSP00000242592	0.907	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
4	9606.ENSP00000385285	0.708	RING finger protein 32
5	9606.ENSP00000359488	0.690	Guanylate-binding protein 5
6	9606.ENSP00000357915	0.629	Solute carrier family 22 member 16
7	9606.ENSP00000303525	0.519	Carbonyl reductase family member 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016878	1.000	acid-thiol ligase activity
GO:0016405	1.000	CoA-ligase activity
GO:0140657	0.997	ATP-dependent activity
GO:0015645	0.991	fatty acid ligase activity
GO:0005488	0.905	binding
GO:0005515	0.812	protein binding
GO:0004467	0.555	long-chain fatty acid-CoA ligase activity
GO:0047760	0.400	butyrate-CoA ligase activity
GO:0031956	0.317	medium-chain fatty acid-CoA ligase activity
GO:0018858	0.303	benzoate-CoA ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0071704	0.972	organic substance metabolic process
GO:0044238	0.939	primary metabolic process
GO:0009410	0.938	response to xenobiotic stimulus
GO:0044281	0.791	small molecule metabolic process
GO:0051716	0.611	cellular response to stimulus
GO:0006805	0.561	xenobiotic metabolic process
GO:0006629	0.516	lipid metabolic process
GO:0019752	0.423	carboxylic acid metabolic process
GO:0006807	0.421	nitrogen compound metabolic process
GO:0009058	0.350	biosynthetic process
GO:1901576	0.340	organic substance biosynthetic process
GO:0044255	0.325	cellular lipid metabolic process
GO:0032787	0.314	monocarboxylic acid metabolic process
GO:1901564	0.304	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.978	intracellular organelle lumen
GO:0005759	0.735	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.1.-	1.000	Acid--thiol ligases.
RHEA:15421	0.555	a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate
EC:6.2.1.3	0.555	long-chain-fatty-acid--CoA ligase.
RHEA:24336	0.400	a carboxylate + ATP + CoA = AMP + an acyl-CoA + diphosphate
EC:6.2.1.2	0.400	medium-chain acyl-CoA ligase.
RHEA:48340	0.317	a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate
RHEA:10132	0.303	ATP + benzoate + CoA = AMP + benzoyl-CoA + diphosphate
EC:6.2.1.25	0.303	benzoate--CoA ligase.

[back to server]