StarFunc result for job id Q08AH3

User Input

>input (577 residues)
MHWLRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWADMEKA
GKRLPSPALWWVNGKGKELMWNFRELSENSQQAANVLSGACGLQRGDRVAVVLPRVPEWW
LVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIK
LLVSEKSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGL
KAKMDAGWTGLQASDIMWTISDTGWILNILCSLMEPWALGACTFVHLLPKFDPLVILKTL
SSYPIKSMMGAPIVYRMLLQQDLSSYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRES
YGQTETGLTCMVSKTMKIKPGYMGTAASCYDVQIIDDKGNVLPPGTEGDIGIRVKPIRPI
GIFSGYVDNPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRANDIINSSGYRIGPSEVEN
ALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQFLSHDPEQLTKELQQHVKSVTAPYKY
PRKIEFVLNLPKTVTGKIQRAKLRDKEWKMSGKARAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3b7wA	0.924	0.993	0.000	537	0.925	0.994	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
2	AFDB:Q08AH3	1.000	1.000	0.000	577	1.000	1.000	Q08AH3.pdb.gz	ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2A PE=1 SV=2
3	AFDB:Q8K0L3	0.957	0.960	0.000	575	0.756	0.758	Q8K0L3.pdb.gz	ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus OX=10090 GN=Acsm2 PE=1 SV=1
4	AFDB:Q3UNX5	0.913	0.908	1.625E-85	580	0.530	0.528	Q3UNX5.pdb.gz	ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus OX=10090 GN=Acsm3 PE=1 SV=2
5	AFDB:Q7TN78	0.748	0.744	6.084E-85	580	0.574	0.571	Q7TN78.pdb.gz	ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsm4 PE=1 SV=1
6	AFDB:Q08AH1	0.902	0.902	1.067E-82	577	0.544	0.544	Q08AH1.pdb.gz	ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM1 PE=1 SV=1
7	AFDB:Q91VA0	0.897	0.903	1.506E-82	573	0.544	0.548	Q91VA0.pdb.gz	ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus OX=10090 GN=Acsm1 PE=1 SV=1
8	AFDB:Q9BEA2	0.736	0.736	7.516E-82	577	0.570	0.570	Q9BEA2.pdb.gz	ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus OX=9913 GN=ACSM1 PE=1 SV=2
9	AFDB:Q53FZ2	0.746	0.735	1.576E-80	586	0.542	0.534	Q53FZ2.pdb.gz	ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM3 PE=1 SV=2
10	AFDB:Q729U8	0.718	0.750	3.746E-62	551	0.360	0.377	Q729U8.pdb.gz	Q729U8_DESVH AMP-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2250 PE=1 SV=1
11	AFDB:A4YDT1	0.689	0.704	1.003E-53	564	0.310	0.317	A4YDT1.pdb.gz	HBCL1_METS5 4-hydroxybutyrate--CoA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0406 PE=1 SV=1
12	PDB:2p20A	0.819	0.741	5.760E-44	641	0.222	0.200	2p20A.pdb.gz	Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.
13	PDB:1ry2A	0.678	0.638	1.426E-41	615	0.236	0.221	1ry2A.pdb.gz	Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP
14	PDB:5bsmA	0.658	0.714	2.390E-41	530	0.229	0.249	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
15	PDB:6q2mA	0.662	0.700	6.343E-41	544	0.218	0.232	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
16	PDB:1ultA	0.654	0.705	1.683E-40	533	0.203	0.220	1ultA.pdb.gz
17	PDB:5ie2A	0.626	0.706	1.330E-39	506	0.213	0.243	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
18	PDB:3r44A	0.638	0.728	3.738E-39	502	0.199	0.229	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
19	PDB:3rg2C	0.794	0.749	9.365E-39	613	0.191	0.179	3rg2C.pdb.gz	Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
20	PDB:7kydA	0.655	0.704	5.211E-37	534	0.210	0.227	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08AH1	0.0	675	577	0.555	0.555	ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM1 PE=1 SV=1
2	Q08AH3	0.0	1199	577	1.000	1.000	ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2A PE=1 SV=2
3	Q3UNX5	0.0	656	580	0.523	0.521	ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus OX=10090 GN=Acsm3 PE=1 SV=2
4	Q53FZ2	0.0	663	586	0.542	0.534	ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM3 PE=1 SV=2
5	Q68CK6	0.0	1169	577	0.972	0.972	ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2B PE=1 SV=2
6	Q7TN78	0.0	680	580	0.562	0.559	ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsm4 PE=1 SV=1
7	Q80W40	0.0	680	580	0.570	0.567	ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus OX=10090 GN=Acsm4 PE=2 SV=1
8	Q8K0L3	0.0	930	575	0.757	0.760	ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus OX=10090 GN=Acsm2 PE=1 SV=1
9	Q91VA0	0.0	658	573	0.549	0.553	ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus OX=10090 GN=Acsm1 PE=1 SV=1
10	Q9BEA2	0.0	695	577	0.570	0.570	ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus OX=9913 GN=ACSM1 PE=1 SV=2
11	Q729U8	1.97e-124	379	551	0.360	0.377	Q729U8_DESVH AMP-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2250 PE=1 SV=1
12	A4YDT1	1.24e-87	284	564	0.302	0.309	HBCL1_METS5 4-hydroxybutyrate--CoA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0406 PE=1 SV=1
13	Q726Y7	3.48e-53	194	661	0.267	0.233	Q726Y7_DESVH Acetyl-coenzyme A synthetase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=acsA PE=1 SV=1
14	P27550	2.17e-46	175	652	0.255	0.225	ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) OX=83333 GN=acs PE=1 SV=2
15	Q99NB1	3.80e-46	174	682	0.263	0.223	ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus OX=10090 GN=Acss1 PE=1 SV=1
16	D3ZZN3	1.20e-44	170	682	0.262	0.221	D3ZZN3_RAT Acetyl-coenzyme A synthetase OS=Rattus norvegicus OX=10116 GN=Acss1 PE=3 SV=1
17	Q9NUB1	2.33e-43	166	689	0.255	0.213	ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens OX=9606 GN=ACSS1 PE=1 SV=2
18	Q8ZKF6	3.80e-43	166	652	0.251	0.222	ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=acs PE=1 SV=1
19	P38135	2.23e-42	162	566	0.267	0.272	FADK_ECOLI Medium-chain fatty-acid--CoA ligase OS=Escherichia coli (strain K12) OX=83333 GN=fadK PE=1 SV=4
20	Q01574	8.56e-42	162	713	0.250	0.202	ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACS1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	1.3e-62	223.5	AMP-binding enzyme
2	PF13193 AMP-binding_C	2.2e-18	78.3	AMP-binding enzyme C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000459451

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242592	0.926	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
2	9606.ENSP00000263174	0.548	Palmdelphin
3	9606.ENSP00000409423	0.548	Protein FAM47E
4	9606.ENSP00000422067	0.536	FAM47E-STBD1 readthrough
5	9606.ENSP00000295802	0.508	All-trans-retinol 13,14-reductase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016878	1.000	acid-thiol ligase activity
GO:0016405	1.000	CoA-ligase activity
GO:0015645	0.870	fatty acid ligase activity
GO:0005488	0.795	binding
GO:0005515	0.790	protein binding
GO:0004467	0.370	long-chain fatty acid-CoA ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.993	cellular metabolic process
GO:0071704	0.984	organic substance metabolic process
GO:0044238	0.981	primary metabolic process
GO:0044281	0.973	small molecule metabolic process
GO:0042221	0.816	response to chemical
GO:0006807	0.810	nitrogen compound metabolic process
GO:0006629	0.802	lipid metabolic process
GO:0009410	0.786	response to xenobiotic stimulus
GO:1901564	0.700	organonitrogen compound metabolic process
GO:1901360	0.578	organic cyclic compound metabolic process
GO:0006163	0.554	purine nucleotide metabolic process
GO:0006082	0.552	organic acid metabolic process
GO:0019752	0.510	carboxylic acid metabolic process
GO:0071466	0.501	cellular response to xenobiotic stimulus
GO:0009150	0.495	purine ribonucleotide metabolic process
GO:0006637	0.451	acyl-CoA metabolic process
GO:0032787	0.414	monocarboxylic acid metabolic process
GO:0006631	0.357	fatty acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.957	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.1.-	1.000	Acid--thiol ligases.
RHEA:15421	0.370	a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate
EC:6.2.1.3	0.370	long-chain-fatty-acid--CoA ligase.

[back to server]