StarFunc result for job id Q08ET2

User Input

>input (396 residues)
MLPLLLLPLLWGGSLQEKPVYELQVQKSVTVQEGLCVLVPCSFSYPWRSWYSSPPLYVYW
FRDGEIPYYAEVVATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSYFFRV
ERGRDVKYSYQQNKLNLEVTALIEKPDIHFLEPLESGRPTRLSCSLPGSCEAGPPLTFSW
TGNALSPLDPETTRSSELTLTPRPEDHGTNLTCQVKRQGAQVTTERTVQLNVSYAPQNLA
ISIFFRNGTGTALRILSNGMSVPIQEGQSLFLACTVDSNPPASLSWFREGKALNPSQTSM
SGTLELPNIGAREGGEFTCRVQHPLGSQHLSFILSVQRSSSSCICVTEKQQGSWPLVLTL
IRGALMGAGFLLTYGLTWIYYTRCGGPQQSRAERPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08ET2	1.000	1.000	3.932E-78	396	1.000	1.000	Q08ET2.pdb.gz	SIG14_HUMAN Sialic acid-binding Ig-like lectin 14 OS=Homo sapiens OX=9606 GN=SIGLEC14 PE=1 SV=1
2	AFDB:O15389	0.749	0.544	1.533E-53	551	0.715	0.514	O15389.pdb.gz	SIGL5_HUMAN Sialic acid-binding Ig-like lectin 5 OS=Homo sapiens OX=9606 GN=SIGLEC5 PE=1 SV=1
3	AFDB:Q9Y336	0.648	0.566	2.230E-43	463	0.477	0.408	Q9Y336.pdb.gz	SIGL9_HUMAN Sialic acid-binding Ig-like lectin 9 OS=Homo sapiens OX=9606 GN=SIGLEC9 PE=1 SV=2
4	AFDB:Q96PQ1	0.614	0.433	8.128E-42	595	0.444	0.296	Q96PQ1.pdb.gz	SIG12_HUMAN Sialic acid-binding Ig-like lectin 12 OS=Homo sapiens OX=9606 GN=SIGLEC12 PE=1 SV=1
5	AFDB:Q9Y286	0.679	0.588	1.633E-41	467	0.482	0.409	Q9Y286.pdb.gz	SIGL7_HUMAN Sialic acid-binding Ig-like lectin 7 OS=Homo sapiens OX=9606 GN=SIGLEC7 PE=1 SV=1
6	AFDB:Q9NYZ4	0.640	0.524	3.653E-41	499	0.495	0.393	Q9NYZ4.pdb.gz	SIGL8_HUMAN Sialic acid-binding Ig-like lectin 8 OS=Homo sapiens OX=9606 GN=SIGLEC8 PE=1 SV=2
7	AFDB:Q91Y57	0.709	0.610	1.018E-39	467	0.432	0.366	Q91Y57.pdb.gz	SIG12_MOUSE Sialic acid-binding Ig-like lectin 12 OS=Mus musculus OX=10090 GN=Siglec12 PE=1 SV=3
8	AFDB:A6NMB1	0.473	0.395	8.344E-37	481	0.417	0.343	A6NMB1.pdb.gz	SIG16_HUMAN Sialic acid-binding Ig-like lectin 16 OS=Homo sapiens OX=9606 GN=SIGLEC16 PE=2 SV=3
9	AFDB:A0A024R4K4	0.683	0.605	1.866E-36	453	0.437	0.382	A0A024R4K4.pdb.gz
10	AFDB:Q920G3	0.651	0.470	4.428E-35	569	0.407	0.283	Q920G3.pdb.gz	SIGL5_MOUSE Sialic acid-binding Ig-like lectin 5 OS=Mus musculus OX=10090 GN=Siglec5 PE=2 SV=1
11	PDB:6dldD	0.327	0.457	1.749E-13	269	0.141	0.208	6dldD.pdb.gz
12	PDB:5oj2B	0.223	0.141	5.695E-13	692	0.174	0.100	5oj2B.pdb.gz
13	PDB:1e07A	0.251	0.181	1.675E-11	642	0.129	0.079	1e07A.pdb.gz
14	PDB:6dlfA	0.265	0.403	2.311E-11	236	0.129	0.216	6dlfA.pdb.gz
15	PDB:1hzhH	0.211	0.185	1.693E-9	457	0.131	0.114	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
16	PDB:1igtB	0.239	0.216	3.401E-9	444	0.184	0.164	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
17	PDB:1igaA	0.226	0.192	8.936E-9	475	0.152	0.126	1igaA.pdb.gz
18	PDB:7q5zA	0.162	0.059	8.069E-8	1344	0.144	0.042	7q5zA.pdb.gz
19	PDB:7q1yA	0.179	0.075	1.308E-7	1374	0.124	0.036	7q1yA.pdb.gz
20	PDB:6feyB	0.205	0.380	1.536E-7	207	0.083	0.159	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15389	0.0	550	551	0.692	0.497	SIGL5_HUMAN Sialic acid-binding Ig-like lectin 5 OS=Homo sapiens OX=9606 GN=SIGLEC5 PE=1 SV=1
2	Q08ET2	0.0	810	396	1.000	1.000	SIG14_HUMAN Sialic acid-binding Ig-like lectin 14 OS=Homo sapiens OX=9606 GN=SIGLEC14 PE=1 SV=1
3	Q9Y336	1.55e-108	328	463	0.467	0.400	SIGL9_HUMAN Sialic acid-binding Ig-like lectin 9 OS=Homo sapiens OX=9606 GN=SIGLEC9 PE=1 SV=2
4	Q9NYZ4	6.39e-107	325	499	0.457	0.363	SIGL8_HUMAN Sialic acid-binding Ig-like lectin 8 OS=Homo sapiens OX=9606 GN=SIGLEC8 PE=1 SV=2
5	Q96PQ1	2.15e-106	327	595	0.434	0.289	SIG12_HUMAN Sialic acid-binding Ig-like lectin 12 OS=Homo sapiens OX=9606 GN=SIGLEC12 PE=1 SV=1
6	Q9Y286	2.94e-105	320	467	0.444	0.377	SIGL7_HUMAN Sialic acid-binding Ig-like lectin 7 OS=Homo sapiens OX=9606 GN=SIGLEC7 PE=1 SV=1
7	O43699	1.06e-104	318	453	0.429	0.375	SIGL6_HUMAN Sialic acid-binding Ig-like lectin 6 OS=Homo sapiens OX=9606 GN=SIGLEC6 PE=1 SV=2
8	Q91Y57	2.55e-101	310	467	0.409	0.347	SIG12_MOUSE Sialic acid-binding Ig-like lectin 12 OS=Mus musculus OX=10090 GN=Siglec12 PE=1 SV=3
9	Q920G3	3.81e-92	290	569	0.409	0.285	SIGL5_MOUSE Sialic acid-binding Ig-like lectin 5 OS=Mus musculus OX=10090 GN=Siglec5 PE=2 SV=1
10	P20138	3.09e-82	258	364	0.336	0.365	CD33_HUMAN Myeloid cell surface antigen CD33 OS=Homo sapiens OX=9606 GN=CD33 PE=1 SV=2
11	Q546G0	3.09e-82	258	364	0.336	0.365	Q546G0_HUMAN CD33 antigen (Gp67) OS=Homo sapiens OX=9606 GN=CD33 PE=4 SV=1
12	Q96RL6	1.35e-80	263	698	0.376	0.213	SIG11_HUMAN Sialic acid-binding Ig-like lectin 11 OS=Homo sapiens OX=9606 GN=SIGLEC11 PE=1 SV=2
13	Q96LC7	2.89e-80	262	697	0.366	0.208	SIG10_HUMAN Sialic acid-binding Ig-like lectin 10 OS=Homo sapiens OX=9606 GN=SIGLEC10 PE=1 SV=3
14	A6NMB1	4.67e-76	245	481	0.356	0.293	SIG16_HUMAN Sialic acid-binding Ig-like lectin 16 OS=Homo sapiens OX=9606 GN=SIGLEC16 PE=2 SV=3
15	Q80ZE3	7.64e-75	247	688	0.361	0.208	SIG10_MOUSE Sialic acid-binding Ig-like lectin 10 OS=Mus musculus OX=10090 GN=Siglec10 PE=1 SV=1
16	Q3Y597	1.38e-61	202	309	0.301	0.385	Q3Y597_MOUSE SIGLEC-H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1
17	Q4QQK7	1.53e-61	202	309	0.301	0.385	Q4QQK7_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1
18	B7ZMQ6	9.85e-61	201	332	0.301	0.358	B7ZMQ6_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1
19	G3X9N0	1.05e-59	197	293	0.288	0.389	G3X9N0_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=4 SV=1
20	A0A4W8	7.67e-59	195	293	0.283	0.382	A0A4W8_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	4.7	19.0	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	1.8e-06	39.2	CD80-like C2-set immunoglobulin domain
3	PF07679 I-set	2.2e-12	58.2	Immunoglobulin I-set domain
4	PF00047 ig	3e-15	67.5	Immunoglobulin domain
5	PF13895 Ig_2	2.8e-18	77.3	Immunoglobulin domain
6	PF13927 Ig_3	9.5e-16	69.5	Immunoglobulin domain
7	PF07686 V-set	4.6e-20	83.2	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354090

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262629	0.995	TYRO protein tyrosine kinase-binding protein
2	9606.ENSP00000302961	0.648	Heat shock protein family A member 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.989	regulation of biological process
GO:0050896	0.929	response to stimulus
GO:0050794	0.919	regulation of cellular process
GO:0023052	0.892	signaling
GO:0051716	0.877	cellular response to stimulus
GO:0048518	0.851	positive regulation of biological process
GO:0007154	0.829	cell communication
GO:0048583	0.792	regulation of response to stimulus
GO:0007165	0.789	signal transduction
GO:0032101	0.662	regulation of response to external stimulus
GO:0031347	0.613	regulation of defense response
GO:0019222	0.558	regulation of metabolic process
GO:0060255	0.540	regulation of macromolecule metabolic process
GO:0051239	0.522	regulation of multicellular organismal process
GO:0048584	0.475	positive regulation of response to stimulus
GO:0002831	0.472	regulation of response to biotic stimulus
GO:0048519	0.438	negative regulation of biological process
GO:0032103	0.361	positive regulation of response to external stimulus
GO:0048522	0.355	positive regulation of cellular process
GO:0002682	0.352	regulation of immune system process
GO:0010468	0.350	regulation of gene expression
GO:0031349	0.319	positive regulation of defense response
GO:0006950	0.314	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.996	cytoplasm
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:0012505	0.986	endomembrane system
GO:0031982	0.965	vesicle
GO:0030667	0.961	secretory granule membrane
GO:0101002	0.364	ficolin-1-rich granule
GO:0070820	0.348	tertiary granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]