StarFunc result for job id Q08J23

User Input

>input (767 residues)
MGRRSRGRRLQQQQRPEDAEDGAEGGGKRGEAGWEGGYPEIVKENKLFEHYYQELKIVPE
GEWGQFMDALREPLPATLRITGYKSHAKEILHCLKNKYFKELEDLEVDGQKVEVPQPLSW
YPEELAWHTNLSRKILRKSPHLEKFHQFLVSETESGNISRQEAVSMIPPLLLNVRPHHKI
LDMCAAPGSKTTQLIEMLHADMNVPFPEGFVIANDVDNKRCYLLVHQAKRLSSPCIMVVN
HDASSIPRLQIDVDGRKEILFYDRILCDVPCSGDGTMRKNIDVWKKWTTLNSLQLHGLQL
RIATRGAEQLAEGGRMVYSTCSLNPIEDEAVIASLLEKSEGALELADVSNELPGLKWMPG
ITQWKVMTKDGQWFTDWDAVPHSRHTQIRPTMFPPKDPEKLQAMHLERCLRILPHHQNTG
GFFVAVLVKKSSMPWNKRQPKLQGKSAETRESTQLSPADLTEGKPTDPSKLESPSFTGTG
DTEIAHATEDLENNGSKKDGVCGPPPSKKMKLFGFKEDPFVFIPEDDPLFPPIEKFYALD
PSFPRMNLLTRTTEGKKRQLYMVSKELRNVLLNNSEKMKVINTGIKVWCRNNSGEEFDCA
FRLAQEGIYTLYPFINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLK
YEPDSANPDALQCPIVLCGWRGKASIRTFVPKNERLHYLRMMGLEVLGEKKKEGVILTNE
SAASTGQPDNDVTEGQRAGEPNSPDAEEANSPDVTAGCDPAGVHPPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08J23	1.000	1.000	0.000	767	1.000	1.000	Q08J23.pdb.gz	NSUN2_HUMAN RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2
2	AFDB:Q1HFZ0	0.827	0.838	0.000	757	0.868	0.880	Q1HFZ0.pdb.gz	NSUN2_MOUSE RNA cytosine C(5)-methyltransferase NSUN2 OS=Mus musculus OX=10090 GN=Nsun2 PE=1 SV=2
3	AFDB:Q9W4M9	0.748	0.768	1.486E-74	746	0.408	0.420	Q9W4M9.pdb.gz	NSUN2_DROME tRNA (cytosine(34)-C(5))-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Nsun2 PE=2 SV=1
4	AFDB:O13935	0.721	0.805	7.354E-71	685	0.331	0.371	O13935.pdb.gz	TRM4B_SCHPO Multisite-specific tRNA:(cytosine-C(5))-methyltransferase trm4b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm4b PE=1 SV=2
5	AFDB:P38205	0.736	0.823	4.028E-69	684	0.327	0.367	P38205.pdb.gz	NCL1_YEAST Multisite-specific tRNA:(cytosine-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCL1 PE=1 SV=1
6	AFDB:Q8L601	0.731	0.695	1.106E-66	808	0.374	0.355	Q8L601.pdb.gz	Q8L601_ARATH S-adenosyl-L-methionine-dependent methyltransferases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=TRM4B PE=1 SV=1
7	AFDB:Q9HGQ2	0.728	0.810	4.202E-66	688	0.312	0.347	Q9HGQ2.pdb.gz	TRM4A_SCHPO Multisite-specific tRNA:(cytosine-C(5))-methyltransferase trm4a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm4a PE=1 SV=3
8	AFDB:Q9BL15	0.727	0.813	3.140E-63	684	0.336	0.377	Q9BL15.pdb.gz	Q9BL15_CAEEL tRNA (cytosine(34)-C(5))-methyltransferase OS=Caenorhabditis elegans OX=6239 GN=nsun-2 PE=1 SV=4
9	AFDB:Q38AT8	0.648	0.670	2.133E-51	740	0.286	0.296	Q38AT8.pdb.gz	Q38AT8_TRYB2 SAM-dependent MTase RsmB/NOP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0080 PE=3 SV=1
10	AFDB:Q57V63	0.638	0.791	2.654E-46	609	0.226	0.284	Q57V63.pdb.gz	Q57V63_TRYB2 SAM-dependent MTase RsmB/NOP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.270 PE=3 SV=1
11	PDB:2frxA	0.454	0.727	3.897E-24	455	0.151	0.255	2frxA.pdb.gz
12	PDB:7nacq	0.350	0.728	7.323E-20	358	0.124	0.265	7nacq.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
13	PDB:5zveB	0.331	0.636	4.632E-17	384	0.111	0.221	5zveB.pdb.gz	Archaeal NSUN6 catalyzes m5C72 modification on a wide-range of specific tRNAs.
14	PDB:3a4tA	0.291	0.813	5.785E-17	258	0.106	0.314	3a4tA.pdb.gz	Crystal structure of Methanocaldococcus jannaschii Trm4 complexed with sinefungin.
15	PDB:1sqfA	0.327	0.573	1.066E-16	425	0.119	0.214	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
16	PDB:5wwrA	0.322	0.517	1.921E-15	461	0.119	0.197	5wwrA.pdb.gz	Structural basis for substrate binding and catalytic mechanism of a human RNA:m5C methyltransferase NSun6
17	PDB:7of5C	0.298	0.628	4.722E-13	338	0.094	0.213	7of5C.pdb.gz	Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
18	PDB:7pd3x	0.318	0.624	5.955E-11	366	0.095	0.199	7pd3x.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
19	PDB:7mq8SD	0.153	0.439	1.059E-6	237	0.055	0.177	7mq8SD.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:7ajuCA	0.152	0.441	1.292E-5	242	0.044	0.140	7ajuCA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08J23	0.0	1596	767	1.000	1.000	NSUN2_HUMAN RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2
2	Q1HFZ0	0.0	1380	757	0.872	0.884	NSUN2_MOUSE RNA cytosine C(5)-methyltransferase NSUN2 OS=Mus musculus OX=10090 GN=Nsun2 PE=1 SV=2
3	Q9W4M9	0.0	543	746	0.411	0.422	NSUN2_DROME tRNA (cytosine(34)-C(5))-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Nsun2 PE=2 SV=1
4	Q8L601	6.50e-152	464	808	0.369	0.350	Q8L601_ARATH S-adenosyl-L-methionine-dependent methyltransferases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=TRM4B PE=1 SV=1
5	O13935	2.53e-143	438	685	0.343	0.384	TRM4B_SCHPO Multisite-specific tRNA:(cytosine-C(5))-methyltransferase trm4b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm4b PE=1 SV=2
6	P38205	7.58e-143	437	684	0.323	0.363	NCL1_YEAST Multisite-specific tRNA:(cytosine-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCL1 PE=1 SV=1
7	Q9HGQ2	2.57e-140	431	688	0.313	0.349	TRM4A_SCHPO Multisite-specific tRNA:(cytosine-C(5))-methyltransferase trm4a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm4a PE=1 SV=3
8	Q9BL15	1.04e-138	426	684	0.330	0.370	Q9BL15_CAEEL tRNA (cytosine(34)-C(5))-methyltransferase OS=Caenorhabditis elegans OX=6239 GN=nsun-2 PE=1 SV=4
9	Q38AT8	5.74e-91	303	740	0.291	0.301	Q38AT8_TRYB2 SAM-dependent MTase RsmB/NOP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0080 PE=3 SV=1
10	Q57V63	5.80e-77	262	609	0.194	0.245	Q57V63_TRYB2 SAM-dependent MTase RsmB/NOP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.270 PE=3 SV=1
11	Q388U8	5.82e-38	154	806	0.159	0.151	Q388U8_TRYB2 Methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0530 PE=3 SV=1
12	Q9V106	5.68e-31	125	311	0.134	0.331	TRCM_PYRAB tRNA (cytosine(49)-C(5))-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=PYRAB06230 PE=1 SV=1
13	Q583H8	1.02e-22	105	525	0.130	0.190	Q583H8_TRYB2 Nucleolar protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.30O21.90 PE=3 SV=1
14	O94268	3.62e-22	103	608	0.149	0.188	NOP2_SCHPO 25S rRNA (cytosine-C(5))-methyltransferase nop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nop2 PE=1 SV=1
15	P40991	7.73e-22	102	618	0.140	0.173	NOP2_YEAST 25S rRNA (cytosine(2870)-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOP2 PE=1 SV=1
16	Q60343	1.07e-21	97.8	274	0.087	0.245	TRM4_METJA tRNA (cytosine(48)-C(5))-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=trm4 PE=1 SV=1
17	P76273	1.21e-20	98.2	479	0.106	0.169	RSMF_ECOLI Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli (strain K12) OX=83333 GN=rsmF PE=1 SV=2
18	Q9TYV5	9.13e-20	96.7	664	0.129	0.149	NSUN1_CAEEL 26S rRNA (cytosine-C(5))-methyltransferase nsun-1 OS=Caenorhabditis elegans OX=6239 GN=nsun-1 PE=1 SV=2
19	P46087	4.44e-19	94.7	812	0.137	0.129	NOP2_HUMAN Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2
20	Q8VYM6	7.23e-19	93.6	671	0.120	0.137	NOP2B_ARATH 26S rRNA (cytosine-C(5))-methyltransferase NOP2B OS=Arabidopsis thaliana OX=3702 GN=NOP2B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01728 FtsJ	52	15.4	FtsJ-like methyltransferase
2	PF01189 Methyltr_RsmB-F	3.8e-35	132.9	16S rRNA methyltransferase RsmB/F

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264670

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296930	0.990	Nucleophosmin
2	9606.ENSP00000314441	0.986	tRNA (guanine-N(7)-)-methyltransferase
3	9606.ENSP00000313950	0.968	Aurora kinase B
4	9606.ENSP00000466967	0.956	tRNA (guanine(26)-N(2))-dimethyltransferase
5	9606.ENSP00000318195	0.952	Nucleolin
6	9606.ENSP00000396673	0.945	pre-rRNA processing protein FTSJ3
7	9606.ENSP00000221801	0.936	rRNA 2'-O-methyltransferase fibrillarin
8	9606.ENSP00000346725	0.930	Pescadillo homolog
9	9606.ENSP00000367030	0.930	tRNA (cytosine(38)-C(5))-methyltransferase
10	9606.ENSP00000348722	0.925	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs . Acts as a regulator of protein synthesis in embryonic stem cells by mediating pseudouridylation of RNA fragments derived from tRNAs (tRFs): pseudouridylated tRFs inhibit translation by targeting the translation initiation complex . Also catalyzes pseudouridylation of mRNAs: mediates pseudouridylation of mRNAs with the consensus sequence 5'-UGUAG-3' . In addition to mRNAs and tRNAs, binds other types of RNAs, such as snRNAs, Y RNAs and vault RNAs, suggesting that it can catalyze pseudouridylation of many RNA types
11	9606.ENSP00000326948	0.913	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase
12	9606.ENSP00000354040	0.909	Nucleolar GTP-binding protein 1
13	9606.ENSP00000423067	0.907	WD repeat-containing protein 36
14	9606.ENSP00000455106	0.906	Ribosome biogenesis protein BOP1
15	9606.ENSP00000203001	0.900	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
16	9606.ENSP00000264279	0.900	Nucleolar protein 58
17	9606.ENSP00000358563	0.896	H/ACA ribonucleoprotein complex subunit 4
18	9606.ENSP00000366396	0.896	5'-3' exoribonuclease 2
19	9606.ENSP00000370589	0.895	Nucleolar protein 56
20	9606.ENSP00000446184	0.895	RRP12-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008174	1.000	mRNA methyltransferase activity
GO:0016428	1.000	tRNA (cytosine-5-)-methyltransferase activity
GO:0003723	0.996	RNA binding
GO:0062152	0.815	mRNA (cytidine-5-)-methyltransferase activity
GO:0005515	0.341	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0016070	0.985	RNA metabolic process
GO:0050794	0.983	regulation of cellular process
GO:0006400	0.975	tRNA modification
GO:0030488	0.974	tRNA methylation
GO:0016071	0.831	mRNA metabolic process
GO:0016556	0.746	mRNA modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	0.997	nucleoplasm
GO:0005730	0.892	nucleolus
GO:0005739	0.868	mitochondrion
GO:0005576	0.750	extracellular region
GO:0070062	0.607	extracellular exosome
GO:0099080	0.335	supramolecular complex
GO:0005829	0.315	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.
RHEA:61464	0.815	a cytidine in mRNA + S-adenosyl-L-methionine = a 5-methylcytidine in mRNA + H(+) + S-adenosyl-L-homocysteine

[back to server]