StarFunc result for job id Q09028

User Input

>input (425 residues)
MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKD
FSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
INHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEG
YGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHE
SLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVAL
WDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAE
DGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP
EGQGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7ZTY4	0.971	0.969	3.637E-80	426	0.936	0.934	Q7ZTY4.pdb.gz	RBBP7_DANRE Histone-binding protein RBBP7 OS=Danio rerio OX=7955 GN=rbbp7 PE=2 SV=1
2	AFDB:Q16576	0.978	0.978	5.822E-79	425	0.894	0.894	Q16576.pdb.gz	RBBP7_HUMAN Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1
3	AFDB:Q24572	0.963	0.952	9.497E-79	430	0.885	0.874	Q24572.pdb.gz	CAF1_DROME Chromatin assembly factor 1 p55 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-55 PE=1 SV=1
4	PDB:6zrdA	0.924	0.955	5.126E-76	411	0.967	1.000	6zrdA.pdb.gz	Structure Based Design of Bicyclic Peptide Inhibitors of RbAp48.
5	PDB:2ybaB	0.890	0.990	2.663E-73	382	0.833	0.927	2ybaB.pdb.gz	Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
6	PDB:3cfvB	0.891	0.963	1.335E-71	393	0.828	0.896	3cfvB.pdb.gz	Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
7	AFDB:P90916	0.947	0.965	2.171E-70	417	0.696	0.710	P90916.pdb.gz	LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans OX=6239 GN=lin-53 PE=1 SV=2
8	AFDB:Q54SD4	0.928	0.933	1.682E-68	423	0.647	0.650	Q54SD4.pdb.gz	RBBD_DICDI Probable histone-binding protein rbbD OS=Dictyostelium discoideum OX=44689 GN=rbbD PE=3 SV=1
9	AFDB:O22467	0.962	0.964	3.939E-67	424	0.654	0.656	O22467.pdb.gz	MSI1_ARATH Histone-binding protein MSI1 OS=Arabidopsis thaliana OX=3702 GN=MSI1 PE=1 SV=1
10	PDB:3gfcA	0.791	0.991	3.111E-64	339	0.798	1.000	3gfcA.pdb.gz
11	AFDB:P90917	0.896	0.923	4.128E-58	412	0.508	0.524	P90917.pdb.gz	RBA1_CAEEL Probable histone-binding protein rba-1 OS=Caenorhabditis elegans OX=6239 GN=rba-1 PE=1 SV=1
12	AFDB:O94244	0.893	0.883	6.845E-56	430	0.492	0.486	O94244.pdb.gz	HAT2_SCHPO Histone acetyltransferase type B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis16 PE=1 SV=1
13	AFDB:O22469	0.900	0.902	8.983E-56	424	0.508	0.509	O22469.pdb.gz	MSI3_ARATH WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana OX=3702 GN=MSI3 PE=1 SV=2
14	PDB:6s29C	0.859	0.925	5.600E-52	394	0.485	0.523	6s29C.pdb.gz
15	AFDB:O14021	0.886	0.874	3.173E-47	431	0.386	0.381	O14021.pdb.gz	PRW1_SCHPO RbAp48-related WD40 repeat-containing protein prw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prw1 PE=1 SV=1
16	PDB:4pswB	0.799	0.925	9.417E-45	366	0.339	0.393	4pswB.pdb.gz	Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
17	PDB:3w15A	0.633	0.790	1.564E-22	336	0.148	0.188	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
18	PDB:5nnzA	0.539	0.668	9.055E-20	335	0.181	0.230	5nnzA.pdb.gz
19	PDB:7tdzD	0.625	0.704	2.995E-19	375	0.144	0.163	7tdzD.pdb.gz	Structure of cytoplasmic ring of nuclear pore complex by integrative cryo-EM and AlphaFold.
20	PDB:7uhyC	0.644	0.479	3.162E-19	578	0.151	0.111	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AQI0	0.0	837	489	0.951	0.826	A0A8I6AQI0_RAT RB binding protein 4, chromatin remodeling factor OS=Rattus norvegicus OX=10116 GN=Rbbp4 PE=1 SV=1
2	E9PC52	0.0	764	416	0.875	0.894	E9PC52_HUMAN RB binding protein 7, chromatin remodeling factor OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1
3	O22467	0.0	577	424	0.642	0.644	MSI1_ARATH Histone-binding protein MSI1 OS=Arabidopsis thaliana OX=3702 GN=MSI1 PE=1 SV=1
4	P90916	0.0	631	417	0.701	0.715	LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans OX=6239 GN=lin-53 PE=1 SV=2
5	Q09028	0.0	879	425	1.000	1.000	RBBP4_HUMAN Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3
6	Q16576	0.0	790	425	0.894	0.894	RBBP7_HUMAN Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1
7	Q24572	0.0	800	430	0.885	0.874	CAF1_DROME Chromatin assembly factor 1 p55 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-55 PE=1 SV=1
8	Q54SD4	0.0	588	423	0.645	0.648	RBBD_DICDI Probable histone-binding protein rbbD OS=Dictyostelium discoideum OX=44689 GN=rbbD PE=3 SV=1
9	Q60972	0.0	879	425	1.000	1.000	RBBP4_MOUSE Histone-binding protein RBBP4 OS=Mus musculus OX=10090 GN=Rbbp4 PE=1 SV=5
10	Q60973	0.0	790	425	0.894	0.894	RBBP7_MOUSE Histone-binding protein RBBP7 OS=Mus musculus OX=10090 GN=Rbbp7 PE=1 SV=1
11	Q6FHQ0	0.0	790	425	0.894	0.894	Q6FHQ0_HUMAN RBBP7 protein (Fragment) OS=Homo sapiens OX=9606 GN=RBBP7 PE=2 SV=1
12	Q6P3H7	0.0	855	424	0.967	0.969	RBBP4_DANRE Histone-binding protein RBBP4 OS=Danio rerio OX=7955 GN=rbbp4 PE=2 SV=3
13	Q71UF4	0.0	790	425	0.894	0.894	RBBP7_RAT Histone-binding protein RBBP7 OS=Rattus norvegicus OX=10116 GN=Rbbp7 PE=2 SV=1
14	Q7ZTY4	0.0	821	426	0.936	0.934	RBBP7_DANRE Histone-binding protein RBBP7 OS=Danio rerio OX=7955 GN=rbbp7 PE=2 SV=1
15	Q5JP01	2.01e-158	450	285	0.532	0.793	Q5JP01_HUMAN RB binding protein 7, chromatin remodeling factor (Fragment) OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1
16	P90917	8.20e-155	446	412	0.508	0.524	RBA1_CAEEL Probable histone-binding protein rba-1 OS=Caenorhabditis elegans OX=6239 GN=rba-1 PE=1 SV=1
17	O22469	8.27e-149	431	424	0.496	0.498	MSI3_ARATH WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana OX=3702 GN=MSI3 PE=1 SV=2
18	O94244	1.47e-145	423	430	0.499	0.493	HAT2_SCHPO Histone acetyltransferase type B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis16 PE=1 SV=1
19	H0YF10	4.04e-129	372	207	0.424	0.870	H0YF10_HUMAN RB binding protein 4, chromatin remodeling factor (Fragment) OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=1
20	H0YDK2	4.11e-115	339	262	0.384	0.622	H0YDK2_HUMAN RB binding protein 4, chromatin remodeling factor (Fragment) OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.37	22.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF12265 CAF1C_H4-bd	5.5e-25	98.7	Histone-binding protein RBBP4 or subunit C of CAF1 complex
3	PF04451 Capsid_NCLDV	2.5e+02	12.9	Large eukaryotic DNA virus major capsid protein
4	PF08662 eIF2A	0.21	23.0	Eukaryotic translation initiation factor eIF2A
5	PF20426 NBCH_WD40	6.1	17.2	Neurobeachin beta propeller domain
6	PF00400 WD40	3.8e-23	92.5	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 8479.XP_005302213.1

Rank	PPI partner	STRING score	Description
1	8479.XP_005289624.1	0.996	Lin-9 DREAM MuvB core complex component
2	8479.XP_005292128.1	0.996	Lin-54 DREAM MuvB core complex component
3	8479.XP_005283159.1	0.990	Polycomb protein SUZ12
4	8479.XP_005311586.1	0.990	Lin-37 DREAM MuvB core complex component
5	8479.XP_005287587.1	0.989	Embryonic ectoderm development
6	8479.XP_005300455.1	0.987	Enhancer of zeste 2 polycomb repressive complex 2 subunit
7	8479.XP_008172509.1	0.986	Zinc finger protein AEBP2 isoform X1
8	8479.XP_008167060.1	0.984	Chromatin assembly factor 1 subunit A isoform X1
9	8479.XP_005314534.1	0.978	Enhancer of zeste 1 polycomb repressive complex 2 subunit
10	8479.XP_008165837.1	0.978	Nucleosome-remodeling factor subunit BPTF
11	8479.XP_008169760.1	0.977	GATA zinc finger domain containing 2A
12	8479.XP_005303370.1	0.975	Chromatin assembly factor 1 subunit B isoform X1
13	8479.XP_005289301.1	0.973	Metastasis associated 1 family member 2
14	8479.XP_005308621.1	0.972	Jumonji and AT-rich interaction domain containing 2
15	8479.XP_005301630.1	0.971	Lin-52 DREAM MuvB core complex component
16	8479.XP_005287640.2	0.968	Histone deacetylase 2
17	8479.XP_005295407.1	0.968	MYB proto-oncogene like 2
18	8479.XP_005302255.1	0.968	Histone deacetylase 1
19	8479.XP_008168726.1	0.968	Mortality factor 4-like protein 1 isoform X1
20	8479.XP_005290516.1	0.959	Histone acetyltransferase type B catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.999	nucleic acid binding
GO:0042393	0.929	histone binding
GO:0019899	0.891	enzyme binding
GO:0003677	0.745	DNA binding
GO:0003682	0.327	chromatin binding
GO:0043565	0.324	sequence-specific DNA binding
GO:0003824	0.312	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0016043	0.961	cellular component organization
GO:0006338	0.946	chromatin remodeling
GO:0044238	0.933	primary metabolic process
GO:0050789	0.929	regulation of biological process
GO:0071704	0.919	organic substance metabolic process
GO:0050896	0.910	response to stimulus
GO:0050794	0.903	regulation of cellular process
GO:0048856	0.896	anatomical structure development
GO:0042221	0.889	response to chemical
GO:0006807	0.884	nitrogen compound metabolic process
GO:0010033	0.874	response to organic substance
GO:0019222	0.859	regulation of metabolic process
GO:0060255	0.849	regulation of macromolecule metabolic process
GO:0043170	0.835	macromolecule metabolic process
GO:0080090	0.752	regulation of primary metabolic process
GO:0051171	0.750	regulation of nitrogen compound metabolic process
GO:0031323	0.749	regulation of cellular metabolic process
GO:0098732	0.743	macromolecule deacylation
GO:0010468	0.733	regulation of gene expression
GO:1901564	0.728	organonitrogen compound metabolic process
GO:0019538	0.705	protein metabolic process
GO:0019219	0.705	regulation of nucleobase-containing compound metabolic process
GO:0009719	0.697	response to endogenous stimulus
GO:0009889	0.688	regulation of biosynthetic process
GO:0031099	0.660	regeneration
GO:0031326	0.608	regulation of cellular biosynthetic process
GO:0051252	0.608	regulation of RNA metabolic process
GO:1901698	0.599	response to nitrogen compound
GO:0009725	0.599	response to hormone
GO:0040007	0.596	growth
GO:0060416	0.593	response to growth hormone
GO:0010556	0.592	regulation of macromolecule biosynthetic process
GO:0036211	0.581	protein modification process
GO:0006355	0.571	regulation of DNA-templated transcription
GO:0048519	0.527	negative regulation of biological process
GO:0048523	0.474	negative regulation of cellular process
GO:0009892	0.427	negative regulation of metabolic process
GO:0010605	0.409	negative regulation of macromolecule metabolic process
GO:0006357	0.394	regulation of transcription by RNA polymerase II
GO:0048518	0.389	positive regulation of biological process
GO:0051172	0.361	negative regulation of nitrogen compound metabolic process
GO:0031324	0.360	negative regulation of cellular metabolic process
GO:0043933	0.358	protein-containing complex organization
GO:0048522	0.340	positive regulation of cellular process
GO:0045934	0.333	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.311	negative regulation of RNA metabolic process
GO:0031327	0.308	negative regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0140513	0.977	nuclear protein-containing complex
GO:0005694	0.966	chromosome
GO:0000785	0.963	chromatin
GO:1902494	0.959	catalytic complex
GO:0005737	0.931	cytoplasm
GO:1990234	0.918	transferase complex
GO:0005829	0.893	cytosol
GO:0005667	0.859	transcription regulator complex
GO:0000118	0.822	histone deacetylase complex
GO:0070603	0.815	SWI/SNF superfamily-type complex
GO:0035097	0.809	histone methyltransferase complex
GO:0016581	0.760	NuRD complex
GO:0035098	0.747	ESC/E(Z) complex
GO:0098687	0.342	chromosomal region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]