StarFunc result for job id Q09161

User Input

>input (790 residues)
MSRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEAD
LPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANN
YNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWV
GKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLK
KDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDYTDDPEG
PVMPGSHSVERFVIEENLHCIIKSHWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELF
QLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHH
LSNFQFRWSWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPAN
PTCIYKYGDESSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVPNPNQDDDDDEGFSFN
PLKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQM
IAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEILHSTIRKMNKHVLKIQKELE
EAKEKLARQHKRRSDDDDRSSDRKDGVLEEQIERLQEKVESAQSEQKNLFLVIFQRFIMI
LTEHLVRCETDGTSVLTPWYKNCIERLQQIFLQHHQIIQQYMVTLENLLFTAELDPHILA
VFQQFCALQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R179	0.983	0.983	7.779E-97	790	1.000	1.000	A0A024R179.pdb.gz
2	PDB:3feyA	0.939	0.975	1.145E-86	761	0.963	1.000	3feyA.pdb.gz
3	PDB:5oobF	0.905	0.996	1.468E-82	718	0.908	0.999	5oobF.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
4	PDB:1h2uA	0.889	0.994	3.569E-81	706	0.889	0.994	1h2uA.pdb.gz	Large-Scale Induced Fit Recognition of an M(7)Gpppg CAP Analogue by the Human Nuclear CAP-Binding Complex
5	AFDB:Q7K4N3	0.947	0.936	7.404E-67	800	0.585	0.578	Q7K4N3.pdb.gz	NCBP1_DROME Nuclear cap-binding protein subunit 1 OS=Drosophila melanogaster OX=7227 GN=Cbp80 PE=1 SV=1
6	AFDB:O01763	0.916	0.907	1.721E-47	798	0.353	0.350	O01763.pdb.gz	NCBP1_CAEEL Nuclear cap-binding protein subunit 1 OS=Caenorhabditis elegans OX=6239 GN=ncbp-1 PE=3 SV=3
7	AFDB:Q9SIU2	0.819	0.766	5.413E-34	848	0.268	0.250	Q9SIU2.pdb.gz	NCBP1_ARATH Nuclear cap-binding protein subunit 1 OS=Arabidopsis thaliana OX=3702 GN=ABH1 PE=1 SV=2
8	PDB:6n7pX	0.829	0.794	1.367E-27	826	0.161	0.154	6n7pX.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
9	AFDB:O14253	0.681	0.689	3.350E-23	780	0.194	0.196	O14253.pdb.gz	NCBP1_SCHPO Nuclear cap-binding protein subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cbc1 PE=1 SV=1
10	AFDB:A0A1D8PEB4	0.678	0.611	7.455E-21	886	0.195	0.174	A0A1D8PEB4.pdb.gz	A0A1D8PEB4_CANAL Gcr3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GCR3 PE=3 SV=1
11	AFDB:P34160	0.691	0.641	1.007E-20	861	0.161	0.148	P34160.pdb.gz	NCBP1_YEAST Nuclear cap-binding protein complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STO1 PE=1 SV=2
12	AFDB:Q17336	0.221	0.196	2.175E-7	897	0.110	0.097	Q17336.pdb.gz	CWC22_CAEEL Pre-mRNA-splicing factor CWC22 homolog OS=Caenorhabditis elegans OX=6239 GN=let-858 PE=2 SV=1
13	AFDB:Q9VJ87	0.223	0.135	8.403E-7	1330	0.092	0.055	Q9VJ87.pdb.gz	CWC22_DROME Pre-mRNA-splicing factor CWC22 homolog OS=Drosophila melanogaster OX=7227 GN=ncm PE=1 SV=3
14	PDB:7dvqV	0.248	0.404	1.257E-6	468	0.076	0.128	7dvqV.pdb.gz	Structure of the activated human minor spliceosome.
15	AFDB:H0Y3P2	0.241	0.222	1.421E-6	869	0.115	0.105	H0Y3P2.pdb.gz	H0Y3P2_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
16	PDB:5gm6Z	0.233	0.392	1.180E-4	447	0.076	0.134	5gm6Z.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:5mqfT	0.212	0.408	3.017E-4	395	0.075	0.149	5mqfT.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
18	PDB:6bk8L	0.208	0.380	3.376E-4	412	0.075	0.143	6bk8L.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
19	PDB:7dkhI	0.100	0.091	5.297E-4	914	0.119	0.103	7dkhI.pdb.gz
20	PDB:7owgB	0.143	0.077	1.515E-3	2152	0.110	0.040	7owgB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q09161	0.0	1647	790	1.000	1.000	NCBP1_HUMAN Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1
2	Q3UYV9	0.0	1618	790	0.980	0.980	NCBP1_MOUSE Nuclear cap-binding protein subunit 1 OS=Mus musculus OX=10090 GN=Ncbp1 PE=1 SV=2
3	Q56A27	0.0	1618	790	0.981	0.981	NCBP1_RAT Nuclear cap-binding protein subunit 1 OS=Rattus norvegicus OX=10116 GN=Ncbp1 PE=1 SV=1
4	Q7K4N3	0.0	982	800	0.585	0.578	NCBP1_DROME Nuclear cap-binding protein subunit 1 OS=Drosophila melanogaster OX=7227 GN=Cbp80 PE=1 SV=1
5	O01763	1.09e-174	524	798	0.357	0.353	NCBP1_CAEEL Nuclear cap-binding protein subunit 1 OS=Caenorhabditis elegans OX=6239 GN=ncbp-1 PE=3 SV=3
6	Q9SIU2	5.59e-82	281	848	0.271	0.252	NCBP1_ARATH Nuclear cap-binding protein subunit 1 OS=Arabidopsis thaliana OX=3702 GN=ABH1 PE=1 SV=2
7	O14253	5.28e-30	129	780	0.182	0.185	NCBP1_SCHPO Nuclear cap-binding protein subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cbc1 PE=1 SV=1
8	A0A1D8PEB4	3.81e-25	114	886	0.219	0.195	A0A1D8PEB4_CANAL Gcr3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GCR3 PE=3 SV=1
9	P34160	1.17e-15	84.0	861	0.094	0.086	NCBP1_YEAST Nuclear cap-binding protein complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STO1 PE=1 SV=2
10	A0A0R4INT7	0.17	37.4	360	0.035	0.078	A0A0R4INT7_DANRE Homer protein homolog 1 isoform 2 OS=Danio rerio OX=7955 GN=homer1 PE=3 SV=1
11	B8JIC5	0.17	37.7	398	0.035	0.070	B8JIC5_DANRE Homer protein homolog 1 isoform 1 OS=Danio rerio OX=7955 GN=homer1 PE=3 SV=1
12	A0A178V0W2	1.1	35.4	806	0.023	0.022	A0A178V0W2_ARATH Kinesin-like protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At4g30790 PE=1 SV=1
13	Q17336	1.1	35.4	897	0.028	0.025	CWC22_CAEEL Pre-mRNA-splicing factor CWC22 homolog OS=Caenorhabditis elegans OX=6239 GN=let-858 PE=2 SV=1
14	G1UB44	1.4	35.0	732	0.029	0.031	MELA_LACAC Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
15	A0A087WPJ3	5.0	33.1	892	0.033	0.029	A0A087WPJ3_MOUSE Protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF),-interacting protein (liprin), alpha 4 (Fragment) OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
16	Q63615	5.3	33.1	597	0.029	0.039	VP33A_RAT Vacuolar protein sorting-associated protein 33A OS=Rattus norvegicus OX=10116 GN=Vps33a PE=1 SV=1
17	B8QI36	5.9	33.1	1187	0.033	0.022	B8QI36_MOUSE Liprin-alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
18	Q69ZW5	5.9	33.1	1140	0.033	0.023	Q69ZW5_MOUSE MKIAA0897 protein (Fragment) OS=Mus musculus OX=10090 GN=Ppfia4 PE=2 SV=1
19	Q4QBZ9	6.0	32.7	464	0.025	0.043	Q4QBZ9_LEIMA Peroxisomal membrane protein PEX14 OS=Leishmania major OX=5664 GN=PEX14 PE=3 SV=1
20	Q91Z80	6.1	32.7	1043	0.033	0.025	LIPA4_RAT Liprin-alpha-4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Ppfia4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09744 Jnk-SapK_ap_N	4.9e+02	12.5	JNK_SAPK-associated protein-1
2	PF02854 MIF4G	2e-27	107.8	MIF4G domain
3	PF09088 MIF4G_like	3.9e-33	126.3	MIF4G like
4	PF09090 MIF4G_like_2	1.2e-84	295.6	MIF4G like
5	PF12718 Tropomyosin_1	5.7e+02	12.1	Tropomyosin like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000020555

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000002099	0.999	Nuclear cap-binding protein subunit 2
2	61853.ENSNLEP00000020985	0.985	Nuclear cap binding subunit 3
3	61853.ENSNLEP00000014584	0.983	Serrate, RNA effector molecule
4	61853.ENSNLEP00000007844	0.982	Negative elongation factor complex member E
5	61853.ENSNLEP00000003432	0.980	RNA binding motif protein 25
6	61853.ENSNLEP00000002167	0.972	Importin subunit alpha
7	61853.ENSNLEP00000022892	0.970	Belongs to the eukaryotic initiation factor 4E family.
8	61853.ENSNLEP00000016993	0.969	Uncharacterized protein
9	61853.ENSNLEP00000011272	0.964	mRNA cap guanine-N7 methyltransferase
10	61853.ENSNLEP00000001761	0.962	Protein argonaute-2
11	61853.ENSNLEP00000017419	0.961	Eukaryotic translation initiation factor 4E family member 2
12	61853.ENSNLEP00000002730	0.951	Small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
13	61853.ENSNLEP00000007252	0.950	SART1, U4/U6.U5 tri-snRNP-associated protein 1
14	61853.ENSNLEP00000018305	0.949	THO complex 2
15	61853.ENSNLEP00000012561	0.946	Aly/REF export factor
16	61853.ENSNLEP00000018945	0.945	Small nuclear ribonucleoprotein D3 polypeptide 18kDa
17	61853.ENSNLEP00000008303	0.943	Small nuclear ribonucleoprotein D1 polypeptide 16kDa
18	61853.ENSNLEP00000006310	0.940	Elongation factor Tu GTP binding domain containing 2
19	61853.ENSNLEP00000022846	0.934	Small nuclear ribonucleoprotein polypeptide E
20	61853.ENSNLEP00000001766	0.933	Ski2 like RNA helicase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000340	0.999	RNA 7-methylguanosine cap binding
GO:0060090	0.924	molecular adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0090304	0.986	nucleic acid metabolic process
GO:0016071	0.982	mRNA metabolic process
GO:0010467	0.944	gene expression
GO:0050789	0.920	regulation of biological process
GO:0006396	0.889	RNA processing
GO:0060255	0.855	regulation of macromolecule metabolic process
GO:0006397	0.835	mRNA processing
GO:0010468	0.812	regulation of gene expression
GO:0048519	0.739	negative regulation of biological process
GO:0050794	0.684	regulation of cellular process
GO:0008380	0.654	RNA splicing
GO:0051171	0.566	regulation of nitrogen compound metabolic process
GO:0010605	0.562	negative regulation of macromolecule metabolic process
GO:0080090	0.559	regulation of primary metabolic process
GO:0000398	0.559	mRNA splicing, via spliceosome
GO:0031323	0.558	regulation of cellular metabolic process
GO:0019219	0.491	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.459	positive regulation of biological process
GO:0051252	0.438	regulation of RNA metabolic process
GO:0010556	0.365	regulation of macromolecule biosynthetic process
GO:0031326	0.365	regulation of cellular biosynthetic process
GO:0048522	0.351	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:1990904	0.926	ribonucleoprotein complex
GO:0140535	0.906	intracellular protein-containing complex
GO:0005739	0.893	mitochondrion
GO:0034518	0.888	RNA cap binding complex
GO:0140513	0.606	nuclear protein-containing complex
GO:0043232	0.332	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]