StarFunc result for job id Q09328

User Input

>input (741 residues)
MALFTPWKLSSQKLGFFLVTFGFIWGMMLLHFTIQQRTQPESSSMLREQILDLSKRYIKA
LAEENRNVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNLVVNGTGTNSTNST
TAVPSLVALEKINVADIINGAQEKCVLPPMDGYPHCEGKIKWMKDMWRSDPCYADYGVDG
STCSFFIYLSEVENWCPHLPWRAKNPYEEADHNSLAEIRTDFNILYSMMKKHEEFRWMRL
RIRRMADAWIQAIKSLAEKQNLEKRKRKKVLVHLGLLTKESGFKIAETAFSGGPLGELVQ
WSDLITSLYLLGHDIRISASLAELKEIMKKVVGNRSGCPTVGDRIVELIYIDIVGLAQFK
KTLGPSWVHYQCMLRVLDSFGTEPEFNHANYAQSKGHKTPWGKWNLNPQQFYTMFPHTPD
NSFLGFVVEQHLNSSDIHHINEIKRQNQSLVYGKVDSFWKNKKIYLDIIHTYMEVHATVY
GSSTKNIPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFN
PPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVDLNNQEEVEDAVKAILNQKIE
PYMPYEFTCEGMLQRINAFIEKQDFCHGQVMWPPLSALQVKLAEPGQSCKQVCQESQLIC
EPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRH
QRVCPCRDFIKGQVALCKDCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q09328	1.000	1.000	0.000	741	1.000	1.000	Q09328.pdb.gz	MGT5A_HUMAN Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A OS=Homo sapiens OX=9606 GN=MGAT5 PE=1 SV=1
2	AFDB:Q1ECU6	0.919	0.918	0.000	742	0.792	0.791	Q1ECU6.pdb.gz	Q1ECU6_DANRE alpha-1,6-mannosyl-glycoprotein 6-beta-N-acetylglucosaminyltransferase OS=Danio rerio OX=7955 GN=zgc:136939 PE=2 SV=1
3	AFDB:Q3V5L5	0.686	0.643	2.425E-75	792	0.445	0.417	Q3V5L5.pdb.gz	MGT5B_HUMAN Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B OS=Homo sapiens OX=9606 GN=MGAT5B PE=1 SV=2
4	AFDB:Q9NDH7	0.667	0.733	5.733E-56	669	0.310	0.344	Q9NDH7.pdb.gz	GLY2_CAEEL Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-2 PE=1 SV=1
5	PDB:1rrvA	0.218	0.359	2.387E-5	401	0.063	0.117	1rrvA.pdb.gz	Crystal Structure of Vancosaminyltransferase Gtfd from the Vancomycin Biosynthetic Pathway: Interactions with Acceptor and Nucleotide Ligands
6	PDB:1iirA	0.225	0.376	3.140E-5	382	0.063	0.123	1iirA.pdb.gz
7	PDB:3okaA	0.276	0.472	2.138E-4	378	0.063	0.124	3okaA.pdb.gz	Acceptor substrate discrimination in phosphatidyl-myo-inositol mannoside synthesis: structural and mutational analysis of mannosyltransferase Corynebacterium glutamicum PimB'.
8	PDB:3d0rB	0.225	0.380	2.520E-4	381	0.058	0.113	3d0rB.pdb.gz
9	PDB:2hy7A	0.233	0.417	5.427E-4	373	0.051	0.102	2hy7A.pdb.gz
10	PDB:5u6nB	0.218	0.315	8.413E-4	448	0.065	0.107	5u6nB.pdb.gz	Differences in salicylic acid glucose conjugations by UGT74F1 and UGT74F2 from Arabidopsis thaliana.
11	PDB:6ijaD	0.195	0.315	1.914E-3	389	0.065	0.123	6ijaD.pdb.gz	Crystal structures of rhamnosyltransferase UGT89C1 from Arabidopsis thaliana reveal the molecular basis of sugar donor specificity for UDP-beta-l-rhamnose and rhamnosylation mechanism.
12	PDB:6inhA	0.231	0.341	2.967E-3	450	0.062	0.102	6inhA.pdb.gz	Hydrophobic recognition allows the glycosyltransferase UGT76G1 to catalyze its substrate in two orientations.
13	PDB:3rhzA	0.221	0.423	3.903E-3	330	0.046	0.103	3rhzA.pdb.gz	Structural and Functional Analysis of a New Subfamily of Glycosyltransferases Required for Glycosylation of Serine-rich Streptococcal Adhesins.
14	PDB:2wtxD	0.206	0.307	4.355E-3	457	0.081	0.131	2wtxD.pdb.gz	Mechanistic Insight Into Enzymatic Glycosyl Transfer with Retention of Configuration Through Analysis of Glycomimetic Inhibitors.
15	AFDB:Q10202	0.112	0.132	1.552E-2	578	0.081	0.104	Q10202.pdb.gz	DBP3_SCHPO ATP-dependent RNA helicase dbp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dbp3 PE=3 SV=1
16	AFDB:C4R6F0	0.046	0.069	6.817E-2	455	0.065	0.105	C4R6F0.pdb.gz	C4R6F0_KOMPG Peroxisomal biogenesis factor 3 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=PAS_chr3_1073 PE=3 SV=1
17	AFDB:O81072	0.210	0.215	1.390E-1	720	0.116	0.119	O81072.pdb.gz	GT11_ARATH Probable xyloglucan galactosyltransferase GT11 OS=Arabidopsis thaliana OX=3702 GN=GT11 PE=2 SV=1
18	AFDB:Q9SA55	0.062	0.094	1.551E-1	420	0.074	0.131	Q9SA55.pdb.gz	Q9SA55_ARATH Pre-mRNA-splicing factor 18 OS=Arabidopsis thaliana OX=3702 GN=PRP18A PE=1 SV=1
19	AFDB:Q9VYV5	0.122	0.140	2.040E-1	619	0.086	0.103	Q9VYV5.pdb.gz	FUT8_DROME Alpha-(1,6)-fucosyltransferase OS=Drosophila melanogaster OX=7227 GN=FucT6 PE=1 SV=1
20	AFDB:P35187	0.125	0.078	2.276E-1	1447	0.096	0.049	P35187.pdb.gz	SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGS1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97259	0.0	1510	740	0.969	0.970	MGT5A_CRIGR Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A OS=Cricetulus griseus OX=10029 GN=MGAT5 PE=1 SV=1
2	Q09328	0.0	1553	741	1.000	1.000	MGT5A_HUMAN Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A OS=Homo sapiens OX=9606 GN=MGAT5 PE=1 SV=1
3	Q1ECU6	0.0	1262	742	0.791	0.790	Q1ECU6_DANRE alpha-1,6-mannosyl-glycoprotein 6-beta-N-acetylglucosaminyltransferase OS=Danio rerio OX=7955 GN=zgc:136939 PE=2 SV=1
4	Q3V5L5	0.0	630	792	0.460	0.431	MGT5B_HUMAN Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B OS=Homo sapiens OX=9606 GN=MGAT5B PE=1 SV=2
5	Q765H6	0.0	636	792	0.466	0.436	MGT5B_MOUSE Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B OS=Mus musculus OX=10090 GN=Mgat5b PE=1 SV=1
6	Q8R4G6	0.0	1512	740	0.972	0.973	MGT5A_MOUSE Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A OS=Mus musculus OX=10090 GN=Mgat5 PE=1 SV=1
7	Q9NDH7	1.66e-123	385	669	0.312	0.345	GLY2_CAEEL Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-2 PE=1 SV=1
8	Q96EE4	1.32e-35	133	140	0.094	0.500	CC126_HUMAN Coiled-coil domain-containing protein 126 OS=Homo sapiens OX=9606 GN=CCDC126 PE=2 SV=2
9	O53649	1.8	34.3	663	0.026	0.029	O53649_MYCTO Endopeptidase, peptidase family M13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT0208 PE=1 SV=1
10	A0A1D8PEV5	2.0	34.3	618	0.046	0.055	A0A1D8PEV5_CANAL Phosphatidylinositol-3-phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAC1 PE=4 SV=1
11	Q8K3P1	2.3	33.9	485	0.040	0.062	P2RX2_MOUSE P2X purinoceptor 2 OS=Mus musculus OX=10090 GN=P2rx2 PE=1 SV=2
12	A0A0P0X9Z7	2.9	33.9	1600	0.019	0.009	CWZF7_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF7 PE=1 SV=2
13	P49653	3.0	33.5	472	0.042	0.066	P2RX2_RAT P2X purinoceptor 2 OS=Rattus norvegicus OX=10116 GN=P2rx2 PE=1 SV=1
14	Q7SZM1	4.5	32.7	390	0.040	0.077	Q7SZM1_DANRE P2X purinoceptor OS=Danio rerio OX=7955 GN=p2xr514 PE=2 SV=1
15	Q6FTS5	6.2	32.7	835	0.043	0.038	Q6FTS5_CANGA Candida glabrata strain CBS138 chromosome F complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TOG1 PE=4 SV=1
16	Q6LA55	7.0	32.7	2699	0.036	0.010	YF49_SCHPO UPF0648 protein C3H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H5.09c PE=3 SV=2
17	O35331	7.1	32.0	312	0.036	0.087	PDXK_RAT Pyridoxal kinase OS=Rattus norvegicus OX=10116 GN=Pdxk PE=1 SV=1
18	Q8W4Q5	7.2	32.3	577	0.028	0.036	RIN3_ARATH E3 ubiquitin protein ligase RIN3 OS=Arabidopsis thaliana OX=3702 GN=RIN3 PE=1 SV=2
19	F4KD92	7.4	32.3	595	0.028	0.035	F4KD92_ARATH RPM1 interacting protein 3 OS=Arabidopsis thaliana OX=3702 GN=RIN3 PE=1 SV=1
20	C9JKF1	7.9	32.3	1283	0.027	0.016	C9JKF1_HUMAN Sterile alpha motif domain containing 9 (Fragment) OS=Homo sapiens OX=9606 GN=SAMD9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15027 DUF4525	1.2e-59	211.4	Domain of unknown function (DUF4525)
2	PF15024 Glyco_transf_18	5.2e-264	888.7	Glycosyltransferase family 18

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386377

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264968	0.976	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
2	9606.ENSP00000338487	0.972	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
3	9606.ENSP00000369055	0.964	Beta-1,4-galactosyltransferase 1
4	9606.ENSP00000481096	0.962	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C
5	9606.ENSP00000421185	0.944	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein MGAT4D
6	9606.ENSP00000254301	0.905	Galectin-3
7	9606.ENSP00000307423	0.872	Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
8	9606.ENSP00000353910	0.844	Alpha-(1,6)-fucosyltransferase
9	9606.ENSP00000391227	0.812	Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B
10	9606.ENSP00000345270	0.808	Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
11	9606.ENSP00000404718	0.789	Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
12	9606.ENSP00000307860	0.712	Disrupted in renal carcinoma 1
13	9606.ENSP00000169298	0.702	Beta-galactoside alpha-2,6-sialyltransferase 1
14	9606.ENSP00000263956	0.685	General transcription factor 3C polypeptide 3
15	9606.ENSP00000261483	0.680	Alpha-mannosidase 2
16	9606.ENSP00000295770	0.656	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B
17	9606.ENSP00000313398	0.642	Alpha-(1,3)-fucosyltransferase 6
18	9606.ENSP00000310696	0.630	Beta-1,4-galactosyltransferase 2
19	9606.ENSP00000415454	0.624	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
20	9606.ENSP00000305595	0.610	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030144	1.000	alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity
GO:0005488	0.999	binding
GO:0046872	0.960	metal ion binding
GO:0046914	0.944	transition metal ion binding
GO:0030145	0.932	manganese ion binding
GO:0005515	0.891	protein binding
GO:0098772	0.826	molecular function regulator activity
GO:0030234	0.817	enzyme regulator activity
GO:0019212	0.800	phosphatase inhibitor activity
GO:0019888	0.785	protein phosphatase regulator activity
GO:0004864	0.782	protein phosphatase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1901576	0.989	organic substance biosynthetic process
GO:0044249	0.989	cellular biosynthetic process
GO:0019538	0.989	protein metabolic process
GO:1901135	0.988	carbohydrate derivative metabolic process
GO:1901137	0.983	carbohydrate derivative biosynthetic process
GO:0036211	0.983	protein modification process
GO:0044260	0.982	cellular macromolecule metabolic process
GO:0009059	0.980	macromolecule biosynthetic process
GO:1901566	0.979	organonitrogen compound biosynthetic process
GO:0034645	0.974	cellular macromolecule biosynthetic process
GO:0009100	0.974	glycoprotein metabolic process
GO:0070085	0.973	glycosylation
GO:0006486	0.961	protein glycosylation
GO:0006487	0.902	protein N-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.994	membrane
GO:0031090	0.972	organelle membrane
GO:0000139	0.953	Golgi membrane
GO:0005576	0.822	extracellular region
GO:0065010	0.795	extracellular membrane-bounded organelle
GO:1903561	0.778	extracellular vesicle
GO:0070062	0.758	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16921	1.000	N(4)-{beta-D-GlcNAc-(1->2)-[beta-D-GlcNAc-(1->4)]-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = H(+) + N(4)-{beta-D-GlcNAc-(1->2)-[beta-D-GlcNAc-(1->4)]-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-[beta-D-GlcNAc-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein] + UDP
EC:2.4.1.155	1.000	alpha-1,6-mannosyl-glycoprotein 6-beta-N-acetylglucosaminyltransferase.

[back to server]