StarFunc result for job id Q09428

User Input

>input (1581 residues)
MPLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHI
HHSTWLHFPGHNLRWILTFMLLFVLVCEIAEGILSDGVTESHHLHLYMPAGMAFMAAVTS
VVYYHNIETSNFPKLLIALLVYWTLAFITKTIKFVKFLDHAIGFSQLRFCLTGLLVILYG
MLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIGKLPIAMRALTNYQRLCEAFDAQVRKDIQGTQGARAIWQALSHAFGRRLV
LSSTFRILADLLGFAGPLCIFGIVDHLGKENDVFQPKTQFLGVYFVSSQEFLANAYVLAV
LLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIMHLSTSNLSMGEMTAGQICNL
VAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRSTLEYSNERLKQTNEMLRGIKLLKLYAWENIFRTRVETTRRKEMTSLRAFAIYT
SISIFMNTAIPIAAVLITFVGHVSFFKEADFSPSVAFASLSLFHILVTPLFLLSSVVRST
VKALVSVQKLSEFLSSAEIREEQCAPHEPTPQGPASKYQAVPLRVVNRKRPAREDCRGLT
GPLQSLVPSADGDADNCCVQIMGGYFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLAALGEMQKVSGAVFWSSLPDSEIGEDPSPERETATDLDIRKRGPVAYASQKPWLLN
ATVEENIIFESPFNKQRYKMVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVA
RALYQHANVVFLDDPFSALDIHLSDHLMQAGILELLRDDKRTVVLVTHKLQYLPHADWII
AMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKATEPPQGLSRAMS
SRDGLLQDEEEEEEEAAESEEDDNLSSMLHQRAEIPWRACAKYLSSAGILLLSLLVFSQL
LKHMVLVAIDYWLAKWTDSALTLTPAARNCSLSQECTLDQTVYAMVFTVLCSLGIVLCLV
TSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGSILNRFSSDCNTIDQHIPSTLE
CLSRSTLLCVSALAVISYVTPVFLVALLPLAIVCYFIQKYFRVASRDLQQLDDTTQLPLL
SHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVRMEYIGACVVL
IAAVTSISNSLHRELSAGLVGLGLTYALMVSNYLNWMVRNLADMELQLGAVKRIHGLLKT
EAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKPVLKHVNALIAPGQKIGICGRT
GSGKSSFSLAFFRMVDTFEGHIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNLD
PERKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTS
IFIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVHTILSADLVIVLKRGAILEFD
KPEKLLSRKDSVFASFVRADK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5wuaE	0.801	0.961	0.000	1312	0.797	0.960	5wuaE.pdb.gz
2	PDB:5ykfB	0.808	0.973	0.000	1309	0.801	0.967	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
3	PDB:6c3oE	0.617	0.743	0.000	1290	0.815	0.998	6c3oE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP
4	PDB:6c3pE	0.761	0.875	0.000	1359	0.858	0.999	6c3pE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP.
5	PDB:6jb1B	0.847	0.979	0.000	1366	0.834	0.966	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
6	PDB:7mitE	0.869	0.953	0.000	1438	0.648	0.713	7mitE.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
7	PDB:7s5xE	0.786	0.873	0.000	1412	0.889	0.995	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
8	PDB:7vluA	0.637	0.847	0.000	1159	0.530	0.723	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
9	AFDB:A0A0R4IC81	0.761	0.790	0.000	1518	0.309	0.322	A0A0R4IC81.pdb.gz	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
10	AFDB:B2RUS7	0.993	0.989	0.000	1588	0.954	0.950	B2RUS7.pdb.gz	B2RUS7_MOUSE ATP-binding cassette, sub-family C (CFTR/MRP), member 8 OS=Mus musculus OX=10090 GN=Abcc8 PE=1 SV=1
11	AFDB:B2RX12	0.735	0.761	0.000	1523	0.310	0.322	B2RX12.pdb.gz	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
12	AFDB:G5EFP3	0.734	0.738	0.000	1573	0.296	0.298	G5EFP3.pdb.gz	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
13	AFDB:O15438	0.756	0.782	0.000	1527	0.298	0.308	O15438.pdb.gz	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
14	AFDB:O60706	0.938	0.957	0.000	1549	0.667	0.680	O60706.pdb.gz	ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens OX=9606 GN=ABCC9 PE=1 SV=2
15	AFDB:P33527	0.761	0.784	0.000	1531	0.313	0.323	P33527.pdb.gz	MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3
16	AFDB:Q28689	0.720	0.727	0.000	1564	0.295	0.298	Q28689.pdb.gz	MRP2_RABIT ATP-binding cassette sub-family C member 2 OS=Oryctolagus cuniculus OX=9986 GN=ABCC2 PE=1 SV=1
17	AFDB:Q3S1M2	0.739	0.760	0.000	1534	0.300	0.309	Q3S1M2.pdb.gz	Q3S1M2_CAEEL Multidrug resistance-associated protein lethal(2)03659 OS=Caenorhabditis elegans OX=6239 GN=mrp-1 PE=1 SV=1
18	AFDB:Q54P13	0.743	0.738	0.000	1593	0.301	0.299	Q54P13.pdb.gz	ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum OX=44689 GN=abcC8 PE=3 SV=1
19	PDB:7mpeA	0.687	0.753	6.655E-89	1428	0.284	0.314	7mpeA.pdb.gz
20	PDB:5ykeB	0.528	0.983	3.005E-88	845	0.517	0.968	5ykeB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS99	758	1215	0.289	0.376	A0A0A0MS99_HUMAN ABC-type glutathione-S-conjugate transporter OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
2	A0A0B4KGI0	598	1408	0.255	0.286	A0A0B4KGI0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Mrp5 PE=4 SV=1
3	A0A0R4IAS5	2087	1557	0.669	0.679	A0A0R4IAS5_DANRE ATP-binding cassette sub-family C member 9 isoform X7 OS=Danio rerio OX=7955 GN=si:dkey-183c2.3 PE=4 SV=2
4	A0A0R4IC81	783	1518	0.314	0.327	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
5	A0A0S0WIA2	694	1492	0.283	0.300	A0A0S0WIA2_DROME Multidrug-Resistance like protein 1, isoform R OS=Drosophila melanogaster OX=7227 GN=MRP PE=1 SV=1
6	A0A1B0GT25	1688	910	0.550	0.956	A0A1B0GT25_MOUSE ATP-binding cassette, sub-family C (CFTR/MRP), member 8 (Fragment) OS=Mus musculus OX=10090 GN=Abcc8 PE=1 SV=1
7	A0A1S4NYG1	3018	1582	0.951	0.951	A0A1S4NYG1_MESAU SUR1 OS=Mesocricetus auratus OX=10036 PE=1 SV=1
8	A0A1U7R319	3019	1582	0.952	0.951	A0A1U7R319_MESAU ATP-binding cassette sub-family C member 8 isoform X2 OS=Mesocricetus auratus OX=10036 GN=Abcc8 PE=1 SV=1
9	A7KVC2	633	1510	0.281	0.294	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
10	B2RUS7	2983	1588	0.954	0.950	B2RUS7_MOUSE ATP-binding cassette, sub-family C (CFTR/MRP), member 8 OS=Mus musculus OX=10090 GN=Abcc8 PE=1 SV=1
11	B2RX12	757	1523	0.302	0.313	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
12	E1B2R7	644	1426	0.272	0.302	E1B2R7_DANRE ATP-binding cassette sub-family C member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=2 SV=1
13	E7EYG0	654	1426	0.273	0.303	E7EYG0_DANRE ATP-binding cassette, sub-family C (CFTR/MRP), member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=4 SV=1
14	E7F118	702	1507	0.282	0.296	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
15	E9Q236	659	1325	0.283	0.338	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
16	F1LR52	646	1288	0.272	0.334	F1LR52_RAT ATP binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=4
17	F1M3J4	657	1325	0.283	0.337	MRP4_RAT ATP-binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=3
18	G3I1T3	2415	2352	0.795	0.534	G3I1T3_CRIGR ATP-sensitive inward rectifier potassium channel 11 (Fragment) OS=Cricetulus griseus OX=10029 GN=I79_017352 PE=1 SV=1
19	I3L4X2	770	1440	0.302	0.331	I3L4X2_HUMAN ABC-type glutathione-S-conjugate transporter (Fragment) OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
20	O15438	729	1527	0.302	0.313	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	6.1e+02	12.2	AAA ATPase domain
2	PF13304 AAA_21	9	17.6	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13401 AAA_22	1.3e+02	14.3	AAA domain
4	PF13479 AAA_24	3.3e+02	12.4	AAA domain
5	PF13481 AAA_25	17	16.4	AAA domain
6	PF13555 AAA_29	3.4	18.8	P-loop containing region of AAA domain
7	PF09818 ABC_ATPase	0.34	21.5	ATPase of the ABC class
8	PF00664 ABC_membrane	7e-81	283.5	ABC transporter transmembrane region
9	PF00005 ABC_tran	1.2e-42	157.1	ABC transporter
10	PF00006 ATP-synt_ab	3.9e+02	12.1	ATP synthase alpha/beta family, nucleotide-binding domain
11	PF06745 ATPase	19	16.1	KaiC
12	PF01926 MMR_HSR1	34	16.0	50S ribosome-binding GTPase
13	PF03193 RsgA_GTPase	29	16.0	RsgA GTPase
14	PF02463 SMC_N	0.00055	31.0	RecF/RecN/SMC N terminal domain
15	PF12615 TraD_N	56	16.1	F sex factor protein N terminal
16	PF06414 Zeta_toxin	73	14.2	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303960

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345708	0.999	ATP-sensitive inward rectifier potassium channel 11
2	9606.ENSP00000380271	0.999	Rap guanine nucleotide exchange factor 4
3	9606.ENSP00000240662	0.997	ATP-sensitive inward rectifier potassium channel 8
4	9606.ENSP00000252826	0.989	Transient receptor potential cation channel subfamily M member 4
5	9606.ENSP00000222812	0.966	Syntaxin-1A
6	9606.ENSP00000395708	0.955	Rap guanine nucleotide exchange factor 3
7	9606.ENSP00000359719	0.909	cAMP-dependent protein kinase catalytic subunit beta
8	9606.ENSP00000366488	0.904	cAMP-dependent protein kinase catalytic subunit gamma
9	9606.ENSP00000309591	0.902	cAMP-dependent protein kinase catalytic subunit alpha
10	9606.ENSP00000341743	0.886	Alpha-endosulfine
11	9606.ENSP00000380432	0.813	Insulin
12	9606.ENSP00000372654	0.809	Aquaporin-4
13	9606.ENSP00000223366	0.782	Glucokinase
14	9606.ENSP00000260645	0.740	ATP-binding cassette sub-family G member 5
15	9606.ENSP00000323568	0.737	Solute carrier family 2, facilitated glucose transporter member 2
16	9606.ENSP00000261200	0.727	ATP-binding cassette sub-family C member 9
17	9606.ENSP00000344155	0.720	ATP-binding cassette sub-family A member 2
18	9606.ENSP00000295108	0.707	Neurogenic differentiation factor 1
19	9606.ENSP00000354490	0.688	Sodium/potassium-transporting ATPase subunit alpha-2
20	9606.ENSP00000387662	0.681	Glucagon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0008324	0.985	monoatomic cation transmembrane transporter activity
GO:0042626	0.985	ATPase-coupled transmembrane transporter activity
GO:0015318	0.984	inorganic molecular entity transmembrane transporter activity
GO:0005488	0.983	binding
GO:0019829	0.979	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0005515	0.974	protein binding
GO:0022890	0.941	inorganic cation transmembrane transporter activity
GO:0005261	0.936	monoatomic cation channel activity
GO:1901363	0.703	heterocyclic compound binding
GO:0099106	0.671	ion channel regulator activity
GO:0097159	0.645	organic cyclic compound binding
GO:0140678	0.629	molecular function inhibitor activity
GO:0015459	0.603	potassium channel regulator activity
GO:1901702	0.579	salt transmembrane transporter activity
GO:0008200	0.577	ion channel inhibitor activity
GO:0005524	0.555	ATP binding
GO:0046873	0.514	metal ion transmembrane transporter activity
GO:0005246	0.481	calcium channel regulator activity
GO:0043531	0.398	ADP binding
GO:0019870	0.350	potassium channel inhibitor activity
GO:0099103	0.323	channel activator activity
GO:0019855	0.323	calcium channel inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.942	cellular process
GO:0065007	0.916	biological regulation
GO:0050789	0.904	regulation of biological process
GO:0050794	0.876	regulation of cellular process
GO:0055085	0.797	transmembrane transport
GO:0098660	0.788	inorganic ion transmembrane transport
GO:0098662	0.763	inorganic cation transmembrane transport
GO:0032879	0.614	regulation of localization
GO:0006811	0.496	monoatomic ion transport
GO:0065008	0.481	regulation of biological quality
GO:0048518	0.469	positive regulation of biological process
GO:0030001	0.462	metal ion transport
GO:0006813	0.401	potassium ion transport
GO:0051049	0.346	regulation of transport
GO:0050896	0.341	response to stimulus
GO:0032501	0.337	multicellular organismal process
GO:0048522	0.318	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0032991	0.975	protein-containing complex
GO:0043231	0.756	intracellular membrane-bounded organelle
GO:1902495	0.721	transmembrane transporter complex
GO:0005737	0.655	cytoplasm
GO:0034705	0.468	potassium channel complex
GO:0098797	0.345	plasma membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.985	Translocases.

[back to server]