StarFunc result for job id Q09472

User Input

>input (2414 residues)
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
INQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINS
MVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAA
GNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQ
PLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMP
NMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
VRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA
GDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQM
PTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQ
NPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAAL
KDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPN
AAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSM
AQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNI
PLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTP
TPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPS
LPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSST
EVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELK
TEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVD
PQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYK
YCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
HHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGE
VTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQE
YGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPP
SEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKE
LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNK
SSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIP
CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQ
SLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTG
QQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPG
PPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHL
EPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISP
LKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPI
PGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGG
MSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYP
PQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSP
QQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHV
SPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNS
DLNSNLSQSTLDIH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IPF2	0.395	0.405	0.000	2349	0.577	0.593	A0A0R4IPF2.pdb.gz	A0A0R4IPF2_DANRE histone acetyltransferase OS=Danio rerio OX=7955 GN=crebbpa PE=1 SV=1
2	AFDB:A0A0R4IUG1	0.402	0.365	0.000	2679	0.628	0.566	A0A0R4IUG1.pdb.gz
3	AFDB:P34545	0.304	0.358	0.000	2017	0.324	0.387	P34545.pdb.gz	CBP1_CAEEL Protein cbp-1 OS=Caenorhabditis elegans OX=6239 GN=cbp-1 PE=1 SV=6
4	AFDB:Q09472	0.999	0.999	0.000	2414	1.000	1.000	Q09472.pdb.gz	EP300_HUMAN Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2
5	AFDB:Q6JHU9	0.476	0.472	0.000	2442	0.622	0.615	Q6JHU9.pdb.gz	CBP_RAT Histone lysine acetyltransferase CREBBP OS=Rattus norvegicus OX=10116 GN=Crebbp PE=1 SV=1
6	AFDB:X1WG57	0.440	0.408	0.000	2615	0.616	0.568	X1WG57.pdb.gz
7	AFDB:A0A0G2QC09	0.054	0.157	2.488E-64	728	0.273	0.905	A0A0G2QC09.pdb.gz	A0A0G2QC09_RAT histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Ep300 PE=4 SV=2
8	AFDB:Q9LE42	0.214	0.297	2.838E-48	1670	0.150	0.217	Q9LE42.pdb.gz	HAC5_ARATH Histone acetyltransferase HAC5 OS=Arabidopsis thaliana OX=3702 GN=HAC5 PE=2 SV=1
9	AFDB:Q9HCM3	0.043	0.046	7.364E-8	1950	0.137	0.169	Q9HCM3.pdb.gz	K1549_HUMAN UPF0606 protein KIAA1549 OS=Homo sapiens OX=9606 GN=KIAA1549 PE=1 SV=4
10	AFDB:X2JEM2	0.042	0.042	2.106E-7	2326	0.126	0.131	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
11	PDB:7tbhA	0.028	0.254	2.912E-4	243	0.026	0.259	7tbhA.pdb.gz	Cryo-EM, Protein Engineering, and Simulation Enable the Development of Peptide Therapeutics against Acute Myeloid Leukemia.
12	PDB:7c3oA	0.085	0.483	3.061E-4	316	0.019	0.142	7c3oA.pdb.gz	Crystal structure of TT109 from CANDIDA ALBICANS
13	PDB:2zfnA	0.089	0.414	1.017E-3	376	0.021	0.133	2zfnA.pdb.gz	Structural insights into histone h3 lysine 56 acetylation by rtt109
14	PDB:3q66C	0.094	0.402	2.381E-3	432	0.023	0.130	3q66C.pdb.gz
15	PDB:6k15H	0.030	0.123	1.676E-2	393	0.017	0.102	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
16	PDB:5isvA	0.025	0.324	3.731E-2	156	0.004	0.058	5isvA.pdb.gz
17	PDB:5jq4B	0.027	0.371	4.335E-2	146	0.006	0.103	5jq4B.pdb.gz
18	PDB:3fixA	0.025	0.300	7.150E-2	165	0.004	0.061	3fixA.pdb.gz
19	PDB:1tiqA	0.034	0.360	8.734E-2	173	0.010	0.133	1tiqA.pdb.gz	Structural and functional evidence for Bacillus subtilis PaiA as a novel N1-spermidine/spermine acetyltransferase.
20	PDB:1iznA	0.031	0.133	1.674E-1	275	0.011	0.098	1iznA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2QC09	565	365	0.127	0.838	A0A0G2QC09_RAT histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Ep300 PE=4 SV=2
2	A0A0R4IPF2	2191	2349	0.583	0.599	A0A0R4IPF2_DANRE histone acetyltransferase OS=Danio rerio OX=7955 GN=crebbpa PE=1 SV=1
3	A0A2R8Q4T2	1652	2267	0.403	0.429	A0A2R8Q4T2_DANRE histone acetyltransferase OS=Danio rerio OX=7955 GN=crebbpa PE=1 SV=1
4	A0A669KB12	4863	2388	0.989	1.000	A0A669KB12_HUMAN histone acetyltransferase OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=1
5	A0A8I6G641	3257	1945	0.752	0.933	A0A8I6G641_RAT histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Ep300 PE=1 SV=1
6	B2RWS6	4127	2412	0.936	0.937	EP300_MOUSE Histone acetyltransferase p300 OS=Mus musculus OX=10090 GN=Ep300 PE=1 SV=2
7	E1B8D6	4100	2411	0.938	0.939	E1B8D6_BOVIN histone acetyltransferase OS=Bos taurus OX=9913 GN=EP300 PE=4 SV=2
8	F1NGB5	2395	2420	0.612	0.610	F1NGB5_CHICK histone acetyltransferase OS=Gallus gallus OX=9031 GN=CREBBP PE=4 SV=4
9	F1RK46	2414	2440	0.621	0.615	F1RK46_PIG histone acetyltransferase OS=Sus scrofa OX=9823 GN=CREBBP PE=1 SV=3
10	I3L466	1295	1105	0.288	0.630	I3L466_HUMAN histone acetyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=CREBBP PE=1 SV=2
11	M9MS40	1213	3282	0.251	0.185	M9MS40_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=nej PE=1 SV=1
12	M9PH39	1220	3266	0.251	0.186	M9PH39_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=nej PE=1 SV=1
13	O01368	1209	3190	0.251	0.190	O01368_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=nej PE=1 SV=1
14	O60424	727	923	0.222	0.581	O60424_HUMAN histone acetyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=CBP PE=4 SV=1
15	P34545	887	2017	0.183	0.219	CBP1_CAEEL Protein cbp-1 OS=Caenorhabditis elegans OX=6239 GN=cbp-1 PE=1 SV=6
16	P45481	2358	2441	0.613	0.606	CBP_MOUSE Histone lysine acetyltransferase CREBBP OS=Mus musculus OX=10090 GN=Crebbp PE=1 SV=3
17	Q09472	4928	2414	1.000	1.000	EP300_HUMAN Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2
18	Q6JHU9	2377	2442	0.618	0.611	CBP_RAT Histone lysine acetyltransferase CREBBP OS=Rattus norvegicus OX=10116 GN=Crebbp PE=1 SV=1
19	Q8BJ14	1274	714	0.273	0.923	Q8BJ14_MOUSE histone acetyltransferase OS=Mus musculus OX=10090 GN=Ep300 PE=2 SV=1
20	Q91XT0	593	353	0.136	0.932	Q91XT0_RAT histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Ep300 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	7.8e-13	59.6	Bromodomain
2	PF09030 Creb_binding	7.4e-32	121.6	Creb binding
3	PF08214 HAT_KAT11	4.3e-67	238.5	Histone acetylation protein
4	PF02172 KIX	7.2e-37	136.8	KIX domain
5	PF16987 KIX_2	0.15	23.4	KIX domain
6	PF11707 Npa1	2.8	18.9	Ribosome 60S biogenesis N-terminal
7	PF06001 RING_CBP-p300	1.2e-19	81.6	CREB-binding protein/p300, atypical RING domain
8	PF02135 zf-TAZ	3.4e-27	106.0	TAZ zinc finger
9	PF00569 ZZ	2.3e-11	54.6	Zinc finger, ZZ type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263253

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000212015	0.999	NAD-dependent protein deacetylase sirtuin-1
2	9606.ENSP00000250003	0.999	Myoblast determination protein 1
3	9606.ENSP00000258149	0.999	E3 ubiquitin-protein ligase Mdm2
4	9606.ENSP00000262160	0.999	Mothers against decapentaplegic homolog 2
5	9606.ENSP00000262238	0.999	Transcriptional repressor protein YY1
6	9606.ENSP00000263754	0.999	Histone acetyltransferase KAT2B
7	9606.ENSP00000264657	0.999	Signal transducer and activator of transcription 3
8	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
9	9606.ENSP00000287820	0.999	Peroxisome proliferator-activated receptor gamma
10	9606.ENSP00000305422	0.999	CCAAT/enhancer-binding protein beta
11	9606.ENSP00000329357	0.999	Transcription factor Sp1
12	9606.ENSP00000332973	0.999	Mothers against decapentaplegic homolog 3
13	9606.ENSP00000339992	0.999	Transcriptional activator Myb
14	9606.ENSP00000341551	0.999	Mothers against decapentaplegic homolog 4
15	9606.ENSP00000344456	0.999	Catenin beta-1
16	9606.ENSP00000346389	0.999	Myocyte-specific enhancer factor 2A
17	9606.ENSP00000354394	0.999	Signal transducer and activator of transcription 1-alpha/beta
18	9606.ENSP00000360266	0.999	Transcription factor AP-1
19	9606.ENSP00000361066	0.999	Nuclear receptor coactivator 3
20	9606.ENSP00000362649	0.999	Histone deacetylase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0004402	1.000	histone acetyltransferase activity
GO:0003677	0.999	DNA binding
GO:0003682	0.998	chromatin binding
GO:0001221	0.995	transcription coregulator binding
GO:0001223	0.980	transcription coactivator binding
GO:0016922	0.956	nuclear receptor binding
GO:0051059	0.936	NF-kappaB binding
GO:0003684	0.916	damaged DNA binding
GO:0008013	0.780	beta-catenin binding
GO:0010484	0.780	histone H3 acetyltransferase activity
GO:0097677	0.773	STAT family protein binding
GO:0050681	0.773	nuclear androgen receptor binding
GO:0010485	0.755	histone H4 acetyltransferase activity
GO:0140065	0.587	peptide butyryltransferase activity
GO:0043565	0.579	sequence-specific DNA binding
GO:1990837	0.565	sequence-specific double-stranded DNA binding
GO:0140068	0.557	histone crotonyltransferase activity
GO:0061920	0.555	protein propionyltransferase activity
GO:0120301	0.555	histone lactyltransferase activity
GO:0004468	0.555	lysine N-acetyltransferase activity, acting on acetyl phosphate as donor
GO:0044013	0.555	histone H2B acetyltransferase activity
GO:0140908	0.555	histone H3K122 acetyltransferase activity
GO:0001067	0.462	transcription regulatory region nucleic acid binding
GO:0000976	0.452	transcription cis-regulatory region binding
GO:0000977	0.326	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0048518	0.987	positive regulation of biological process
GO:0050794	0.986	regulation of cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0010604	0.982	positive regulation of macromolecule metabolic process
GO:0009987	0.978	cellular process
GO:0010468	0.955	regulation of gene expression
GO:0006355	0.936	regulation of DNA-templated transcription
GO:0006357	0.934	regulation of transcription by RNA polymerase II
GO:0045935	0.929	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.925	positive regulation of macromolecule biosynthetic process
GO:1903508	0.922	positive regulation of nucleic acid-templated transcription
GO:0045893	0.912	positive regulation of DNA-templated transcription
GO:0045944	0.884	positive regulation of transcription by RNA polymerase II
GO:0071704	0.881	organic substance metabolic process
GO:0044238	0.880	primary metabolic process
GO:0006807	0.850	nitrogen compound metabolic process
GO:0043170	0.844	macromolecule metabolic process
GO:0006950	0.709	response to stress
GO:1901564	0.704	organonitrogen compound metabolic process
GO:0019538	0.688	protein metabolic process
GO:0032502	0.657	developmental process
GO:0036211	0.639	protein modification process
GO:0048519	0.570	negative regulation of biological process
GO:0048583	0.568	regulation of response to stimulus
GO:0048856	0.567	anatomical structure development
GO:0051716	0.558	cellular response to stimulus
GO:0032501	0.511	multicellular organismal process
GO:0010628	0.445	positive regulation of gene expression
GO:0009892	0.410	negative regulation of metabolic process
GO:0007154	0.380	cell communication
GO:0065009	0.364	regulation of molecular function
GO:0010605	0.360	negative regulation of macromolecule metabolic process
GO:0048523	0.359	negative regulation of cellular process
GO:0023052	0.352	signaling
GO:0042221	0.350	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.985	cytosol
GO:0032991	0.968	protein-containing complex
GO:0043232	0.591	intracellular non-membrane-bounded organelle
GO:0005694	0.361	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	1.000	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	1.000	histone acetyltransferase.
RHEA:53912	0.587	butanoyl-CoA + L-lysyl-[protein] = CoA + H(+) + N(6)-butanoyl-L-lysyl-[protein]
RHEA:53908	0.557	(2E)-butenoyl-CoA + L-lysyl-[protein] = CoA + H(+) + N(6)-(2E)-butenoyl-L-lysyl-[protein]
RHEA:61996	0.555	L-lysyl-[protein] + lactoyl-CoA = CoA + H(+) + N(6)-lactoyl-L-lysyl-[protein]
RHEA:14417	0.555	acetyl phosphate + L-lysine = H(+) + N(6)-acetyl-L-lysine + phosphate
EC:2.3.1.32	0.555	lysine N-acetyltransferase.

[back to server]