StarFunc result for job id Q09MP3

User Input

>input (1159 residues)
MSLPQPTPRMAELRKPTSSLTPPEDPDSQPPSSKRLCLEEPGGVFKAGWRLPLVPRLSEA
EKVWELSPRPFKGLLVSTNAIFDNSTDSCVEKSVSGKQICNLKCSNLKFQMSSCLQSPPS
QSPDSDLRASGRSEAGLHDREAFSVHRSNSSKAGVSQLLPSTSIHDIHGIRNENRKQQFV
QGRDNVHKENPFLDVTFYKETKSPFHEIKNRCKANSVVPSNKRENNISSSVLKISKSQNQ
PSLEIAKPSYFRDSGTISVPQFPMDLNSKMSSVYLKEIAKKKNDKKEAYVRDFTNIYWSQ
NRPDVKKQKLQNDKKTVEAENIFSKCYENDYPSLSSQNTCKRKDLISSNYCNCSSIQCNV
RDSRKNFAILENANWEEAECLDSYVLTRLEKSQNWDCNVRHILRRNRGNCWIINNCKTKC
ENMKKTEEKWNWLLLLEIDLLSKEDYHCAKVINAYEEQSKLLVREILGSQTALITTVWLN
GKGENDNTLQLRYNTTQKVFHVNNPFESFIIEIFYFHKSISGNKKDNSILTCCNILKCKK
QIGIIGIQNLITRNMNTNIKNGILSIYLQDSVSEPLDILLKTNIAFLLNNFDSLTRIEND
FELEEECIFKCMLYLKYPKNIVENHTAYLVKILTSSRLLEDNMKPMLKKRKLFRTEQVFE
KSKKKLINSFSMTTQNTGFPIFETYEKIPLLMDFDDMDEISLIREITCQNMSCPQQVVNV
ENWAHYNSSTVKAHGNSCPQFIQNNRGYINENFYEVNMHSQDLNMERKQGHNKISNFDCE
HIFEDLCNVRQQAIPASHNIIHNEETHTTSITQVLNFWNLLSEIEEKKYDLILKEEVKVT
AESLTNSCQVHKDTKIEKEEKDSFFPMDDMFSVQSVSLISKEVNVEENKYVNQNYVTNTN
EYESILPEREIANSKDFHRKNDSALYINHQFETGLSEGNDECFQDLAAKYLSTEALTIVK
DFEMKRKFDLVLEELRMFHEISRENELLSTVETNNGQENYFGENDAEKVKMEIEKDLKMV
VVNKIRASSSFHDTIAGPNMGKSHQSLFKWKTVPNNGEQEVPNESCYPSRSEEELLYSTS
EKDCETPLPKRPAFLPDECKEEFNYLLRGGSHFPHGISRVRPLKTCSRPIRIGLSRKARI
KQLHPYLKQMCYGNLKENF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q09MP3	1.000	1.000	0.000	1159	1.000	1.000	Q09MP3.pdb.gz	R51A2_HUMAN RAD51-associated protein 2 OS=Homo sapiens OX=9606 GN=RAD51AP2 PE=1 SV=1
2	AFDB:Q8IRB5	0.067	0.055	5.997E-6	1465	0.147	0.116	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
3	AFDB:Q86V38	0.047	0.046	9.668E-5	1191	0.104	0.102	Q86V38.pdb.gz	Q86V38_HUMAN Atrophin 1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=1
4	AFDB:F8W2W1	0.050	0.053	2.286E-4	1078	0.116	0.124	F8W2W1.pdb.gz
5	AFDB:Q9VFH4	0.050	0.049	2.609E-4	1200	0.120	0.116	Q9VFH4.pdb.gz	Q9VFH4_DROME LD12755p OS=Drosophila melanogaster OX=7227 GN=l(3)L1231 PE=2 SV=1
6	AFDB:D3Z8E6	0.048	0.036	2.788E-4	1604	0.123	0.089	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
7	AFDB:E9PFQ4	0.038	0.039	2.788E-4	1115	0.104	0.108	E9PFQ4.pdb.gz	E9PFQ4_HUMAN Pleckstrin homology like domain family B member 2 (Fragment) OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=1
8	AFDB:Q86SQ0	0.046	0.043	3.400E-4	1253	0.115	0.106	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
9	AFDB:Q56A10	0.044	0.037	3.882E-4	1511	0.139	0.107	Q56A10.pdb.gz	ZN608_MOUSE Zinc finger protein 608 OS=Mus musculus OX=10090 GN=Znf608 PE=1 SV=1
10	AFDB:Q57U60	0.062	0.061	3.882E-4	1172	0.111	0.110	Q57U60.pdb.gz	Q57U60_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.6H23.100 PE=4 SV=1
11	PDB:5wviU	0.039	0.115	9.627E-1	282	0.016	0.064	5wviU.pdb.gz	High-resolution cryo-EM structure of the proteasome in complex with ADP-AlFx
12	PDB:2l3aA	0.032	0.194	2.598	82	0.007	0.098	2l3aA.pdb.gz
13	PDB:6zonF	0.038	0.102	2.966	269	0.012	0.052	6zonF.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
14	PDB:6zm5U	0.018	0.108	3.169	133	0.006	0.053	6zm5U.pdb.gz	Mechanism of membrane-tethered mitochondrial protein synthesis.
15	PDB:5wj9A	0.037	0.075	4.412	479	0.018	0.044	5wj9A.pdb.gz	Human TRPML1 channel structures in open and closed conformations.
16	PDB:6j6qF	0.024	0.137	4.714	161	0.012	0.087	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
17	PDB:3gn5A	0.032	0.157	5.037	132	0.009	0.083	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
18	PDB:2mgsA	0.031	0.299	5.382	71	0.008	0.127	2mgsA.pdb.gz
19	PDB:1vpzA	0.027	0.188	5.750	57	0.006	0.123	1vpzA.pdb.gz
20	PDB:3j7wA	0.023	0.066	5.750	343	0.013	0.044	3j7wA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q09MP3	0.0	2397	1159	1.000	1.000	R51A2_HUMAN RAD51-associated protein 2 OS=Homo sapiens OX=9606 GN=RAD51AP2 PE=1 SV=1
2	Q9FFN1	0.28	37.7	896	0.016	0.020	PP363_ARATH Pentatricopeptide repeat-containing protein At5g03800 OS=Arabidopsis thaliana OX=3702 GN=EMB175 PE=2 SV=1
3	P18962	9.6	32.7	818	0.016	0.022	DAP2_YEAST Dipeptidyl aminopeptidase B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DAP2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15696 RAD51_interact	1.6e-14	65.1	RAD51 interacting motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382030

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368720	0.629	Controls the stability of the leptin mRNA harboring an AU- rich element (ARE) in its 3' UTR, in cooperation with the RNA stabilizer ELAVL1 . Decreases the stability of the leptin mRNA by antagonizing the function of ELAVL1 by inducing its atypical recruitment from the nucleus to the cytosol (By similarity). Binds to cardiolipin (CL), phosphatidic acid (PA), phosphatidylinositol 4-phosphate (PtdIns(4)P) and phosphatidylserine (PS) . Promotes apoptosis by enhancing BAX-BAK hetero-oligomerization via interaction with BID in colon cancer cells (By similarity). ECO:0000269\|PubMed:18191643, [...]
2	9606.ENSP00000228843	0.563	RAD51-associated protein 1
3	9606.ENSP00000301896	0.538	Membrane-anchored junction protein
4	9606.ENSP00000340644	0.525	Telomere repeats-binding bouquet formation protein 2
5	9606.ENSP00000291560	0.524	Heat shock factor 2-binding protein
6	9606.ENSP00000463762	0.522	Telomere repeats-binding bouquet formation protein 1
7	9606.ENSP00000367890	0.514	NAD kinase
8	9606.ENSP00000459580	0.503	Spermatogenesis-associated protein 22
9	9606.ENSP00000448228	0.502	Spermatogenesis-associated serine-rich protein 2
10	9606.ENSP00000333018	0.500	Tetratricopeptide repeat domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.971	cellular process
GO:0000003	0.958	reproduction
GO:0065007	0.947	biological regulation
GO:0050789	0.905	regulation of biological process
GO:0050794	0.902	regulation of cellular process
GO:0022414	0.818	reproductive process
GO:0008152	0.768	metabolic process
GO:0071840	0.726	cellular component organization or biogenesis
GO:0071704	0.726	organic substance metabolic process
GO:0016043	0.713	cellular component organization
GO:0044237	0.676	cellular metabolic process
GO:0006807	0.669	nitrogen compound metabolic process
GO:0044238	0.660	primary metabolic process
GO:0043170	0.638	macromolecule metabolic process
GO:0032502	0.493	developmental process
GO:0019222	0.490	regulation of metabolic process
GO:0007049	0.465	cell cycle
GO:0060255	0.463	regulation of macromolecule metabolic process
GO:0046483	0.396	heterocycle metabolic process
GO:0044260	0.385	cellular macromolecule metabolic process
GO:0006139	0.385	nucleobase-containing compound metabolic process
GO:0090304	0.384	nucleic acid metabolic process
GO:0032501	0.358	multicellular organismal process
GO:0006996	0.330	organelle organization
GO:0022402	0.328	cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0043231	0.950	intracellular membrane-bounded organelle
GO:0005634	0.936	nucleus
GO:0070013	0.924	intracellular organelle lumen
GO:0043232	0.905	intracellular non-membrane-bounded organelle
GO:0031981	0.784	nuclear lumen
GO:0005737	0.732	cytoplasm
GO:0005654	0.511	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]