StarFunc result for job id Q0D2K3

User Input

>input (151 residues)
MDSAACAAAATPVPALALALAPDLAQAPLALPGLLSPSCLLSSGQEVNGSERGTCLWRPW
LSSTNDSPRQMRKLVDLAAGGATAAEVTKAESKFHHPVRLFWPKSRSFDYLYSAGEILLQ
NFPVQATINLYEDSDSEEEEEDEEQEDEEEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0D2K3	1.000	1.000	7.833E-26	151	1.000	1.000	Q0D2K3.pdb.gz	RIPP1_HUMAN Protein ripply1 OS=Homo sapiens OX=9606 GN=RIPPLY1 PE=1 SV=1
2	AFDB:Q2WG77	0.404	0.317	1.459E-13	201	0.603	0.453	Q2WG77.pdb.gz	RIPP1_MOUSE Protein ripply1 OS=Mus musculus OX=10090 GN=Ripply1 PE=2 SV=1
3	AFDB:Q8QGU6	0.305	0.368	2.289E-7	121	0.291	0.364	Q8QGU6.pdb.gz	LEDGE_XENLA Protein ripply2.1 OS=Xenopus laevis OX=8355 GN=ripply2.1 PE=2 SV=1
4	AFDB:Q25QX6	0.307	0.303	2.454E-7	153	0.311	0.307	Q25QX6.pdb.gz	BOWL_XENLA Protein ripply2.2 OS=Xenopus laevis OX=8355 GN=ripply2.2 PE=1 SV=1
5	AFDB:Q5TAB7	0.427	0.493	2.630E-7	128	0.298	0.352	Q5TAB7.pdb.gz	RIPP2_HUMAN Protein ripply2 OS=Homo sapiens OX=9606 GN=RIPPLY2 PE=1 SV=1
6	AFDB:Q2WG76	0.320	0.368	3.994E-7	128	0.285	0.336	Q2WG76.pdb.gz	RIPP2_MOUSE Protein ripply2 OS=Mus musculus OX=10090 GN=Ripply2 PE=2 SV=1
7	AFDB:Q2WG80	0.302	0.321	1.216E-6	140	0.318	0.343	Q2WG80.pdb.gz	RIPP1_DANRE Protein ripply1 OS=Danio rerio OX=7955 GN=ripply1 PE=1 SV=1
8	AFDB:B7XDF1	0.260	0.234	3.432E-5	170	0.272	0.241	B7XDF1.pdb.gz	DSCR6_XENLA Protein ripply3 OS=Xenopus laevis OX=8355 GN=ripply3 PE=1 SV=1
9	AFDB:Q5I2D0	0.242	0.237	3.432E-5	154	0.232	0.227	Q5I2D0.pdb.gz	RIPP_BRABE Protein ripply OS=Branchiostoma belcheri OX=7741 GN=RIPPLY PE=2 SV=1
10	AFDB:P57055	0.242	0.199	9.688E-4	190	0.278	0.221	P57055.pdb.gz	DSCR6_HUMAN Protein ripply3 OS=Homo sapiens OX=9606 GN=RIPPLY3 PE=1 SV=1
11	PDB:6tqeA	0.165	0.049	1.223	634	0.040	0.009	6tqeA.pdb.gz	A mycobacterial ABC transporter mediates the uptake of hydrophilic compounds.
12	PDB:7anwA	0.181	0.049	1.615	645	0.053	0.012	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
13	PDB:6slmA	0.189	0.060	1.732	539	0.020	0.006	6slmA.pdb.gz	Structure of High-Risk Papillomavirus 31 E6 Oncogenic Protein and Characterization of E6/E6AP/p53 Complex Formation.
14	PDB:5eduB	0.182	0.044	1.856	723	0.020	0.004	5eduB.pdb.gz	Histone deacetylase 6 structure and molecular basis of catalysis and inhibition.
15	PDB:4n0iA	0.174	0.068	2.134	450	0.046	0.016	4n0iA.pdb.gz	Crystal structure of Saccharomyces cerevisiae mitochondrial GatFAB reveals a novel subunit assembly in tRNA-dependent amidotransferases
16	PDB:1puiA	0.167	0.151	2.287	169	0.040	0.036	1puiA.pdb.gz
17	PDB:1nmnA	0.185	0.224	2.452	120	0.053	0.067	1nmnA.pdb.gz
18	PDB:1emdA	0.161	0.089	2.629	312	0.026	0.013	1emdA.pdb.gz	Crystal structure of a ternary complex of Escherichia coli malate dehydrogenase citrate and NAD at 1.9 A resolution.
19	PDB:6c0fI	0.163	0.092	2.629	288	0.040	0.021	6c0fI.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
20	PDB:4wrnA	0.183	0.047	3.022	693	0.020	0.004	4wrnA.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0D2K3	3.48e-108	306	151	1.000	1.000	RIPP1_HUMAN Protein ripply1 OS=Homo sapiens OX=9606 GN=RIPPLY1 PE=1 SV=1
2	Q2WG77	3.48e-45	148	201	0.464	0.348	RIPP1_MOUSE Protein ripply1 OS=Mus musculus OX=10090 GN=Ripply1 PE=2 SV=1
3	Q2WG76	5.26e-23	89.7	128	0.272	0.320	RIPP2_MOUSE Protein ripply2 OS=Mus musculus OX=10090 GN=Ripply2 PE=2 SV=1
4	Q5TAB7	2.87e-22	87.8	128	0.291	0.344	RIPP2_HUMAN Protein ripply2 OS=Homo sapiens OX=9606 GN=RIPPLY2 PE=1 SV=1
5	Q2WG80	1.73e-19	80.9	140	0.285	0.307	RIPP1_DANRE Protein ripply1 OS=Danio rerio OX=7955 GN=ripply1 PE=1 SV=1
6	Q8QGU6	2.77e-15	69.7	121	0.238	0.298	LEDGE_XENLA Protein ripply2.1 OS=Xenopus laevis OX=8355 GN=ripply2.1 PE=2 SV=1
7	Q25QX6	5.23e-15	69.7	153	0.238	0.235	BOWL_XENLA Protein ripply2.2 OS=Xenopus laevis OX=8355 GN=ripply2.2 PE=1 SV=1
8	B7XDF1	1.62e-12	63.5	170	0.258	0.229	DSCR6_XENLA Protein ripply3 OS=Xenopus laevis OX=8355 GN=ripply3 PE=1 SV=1
9	Q924S9	2.26e-12	62.8	152	0.205	0.204	DSCR6_MOUSE Protein ripply3 OS=Mus musculus OX=10090 GN=Ripply3 PE=1 SV=2
10	Q2WG78	3.02e-12	61.6	110	0.232	0.318	DSCR6_DANRE Protein ripply3 OS=Danio rerio OX=7955 GN=ripply3 PE=3 SV=1
11	P57055	2.72e-11	60.8	190	0.212	0.168	DSCR6_HUMAN Protein ripply3 OS=Homo sapiens OX=9606 GN=RIPPLY3 PE=1 SV=1
12	Q5I2D0	9.69e-11	58.5	154	0.219	0.214	RIPP_BRABE Protein ripply OS=Branchiostoma belcheri OX=7741 GN=RIPPLY PE=2 SV=1
13	Q9LT25	0.22	33.5	835	0.152	0.028	PR40C_ARATH Pre-mRNA-processing protein 40C OS=Arabidopsis thaliana OX=3702 GN=PRP40C PE=1 SV=1
14	Q960A9	1.7	31.2	1728	0.205	0.018	Q960A9_DROME SD10541p OS=Drosophila melanogaster OX=7227 GN=Sbf PE=2 SV=1
15	Q7KSP6	1.9	30.8	1973	0.205	0.016	Q7KSP6_DROME SET domain binding factor, isoform B OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=1
16	Q91V24	1.9	30.8	2159	0.179	0.013	ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus OX=10090 GN=Abca7 PE=1 SV=1
17	Q9VGH9	2.0	30.8	1993	0.205	0.016	Q9VGH9_DROME SET domain binding factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=3
18	O96610	2.1	30.8	1750	0.205	0.018	O96610_DROME SET domain binding factor OS=Drosophila melanogaster OX=7227 GN=Sbf PE=2 SV=1
19	Q5AF44	4.6	29.3	176	0.086	0.074	Q5AF44_CANAL Thioredoxin peroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AHP1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05086 Dicty_REP	2.3e+02	11.2	Dictyostelium (Slime Mold) REP protein
2	PF14998 Ripply	7e-32	121.2	Transcription Regulator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276173

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342392	0.714	Mesoderm posterior protein 2
2	9606.ENSP00000365682	0.707	Transducin-like enhancer protein 1
3	9606.ENSP00000365720	0.696	Transducin-like enhancer protein 4
4	9606.ENSP00000221561	0.694	Amino-terminal enhancer of split
5	9606.ENSP00000466542	0.694	Transducin-like enhancer protein 2
6	9606.ENSP00000378650	0.686	T-box transcription factor TBX6
7	9606.ENSP00000452871	0.664	Transducin-like enhancer protein 3
8	9606.ENSP00000300057	0.600	Mesoderm posterior protein 1
9	9606.ENSP00000314480	0.582	Homeobox protein unc-4 homolog
10	9606.ENSP00000347821	0.519	MORC family CW-type zinc finger 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.997	anatomical structure development
GO:0050794	0.993	regulation of cellular process
GO:0007389	0.991	pattern specification process
GO:0009987	0.984	cellular process
GO:0009653	0.978	anatomical structure morphogenesis
GO:0003002	0.958	regionalization
GO:0010468	0.954	regulation of gene expression
GO:0048646	0.948	anatomical structure formation involved in morphogenesis
GO:0043009	0.931	chordate embryonic development
GO:0009952	0.897	anterior/posterior pattern specification
GO:0048513	0.872	animal organ development
GO:0009888	0.869	tissue development
GO:0051171	0.672	regulation of nitrogen compound metabolic process
GO:0051716	0.652	cellular response to stimulus
GO:0035282	0.629	segmentation
GO:0009887	0.616	animal organ morphogenesis
GO:0019219	0.561	regulation of nucleobase-containing compound metabolic process
GO:0048731	0.529	system development
GO:0051252	0.516	regulation of RNA metabolic process
GO:0006355	0.488	regulation of DNA-templated transcription
GO:0031324	0.465	negative regulation of cellular metabolic process
GO:0010605	0.464	negative regulation of macromolecule metabolic process
GO:0051253	0.448	negative regulation of RNA metabolic process
GO:0010558	0.441	negative regulation of macromolecule biosynthetic process
GO:0007165	0.438	signal transduction
GO:0045892	0.429	negative regulation of DNA-templated transcription
GO:0060429	0.382	epithelium development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.954	intracellular organelle lumen
GO:0031981	0.865	nuclear lumen
GO:0005654	0.695	nucleoplasm
GO:0032991	0.693	protein-containing complex
GO:0005667	0.423	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]