StarFunc result for job id Q0IIM8

User Input

>input (1120 residues)
MWLKPEEVLLKNALKLWLMERSNDYFVLQRRRGYGEEGGGGLTGLLVGTLDSVLDSTAKV
APFRILHQTPDSQVYLSIACGANREEITKHWDWLEQNIMKTLSVFDSNEDITNFVQGKIR
GLIAEEGKHCFAKEDDPEKFREALLKFEKCFGLPEKEKLVTYYSCSYWKGRVPCQGWLYL
STNFLSFYSFLLGSEIKLIISWDEVSKLEKTSNVILTESIHVCSQGENHYFSMFLHINQT
YLLMEQLANYAIRRLFDKETFDNDPVLYNPLQITKRGLENRAHSEQFNAFFRLPKGESLK
EVHECFLWVPFSHFNTHGKMCISENYICFASQDGNQCSVIIPLREVLAIDKTNDSSKSVI
ISIKGKTAFRFHEVKDFEQLVAKLRLRCGAASTQYHDISTELAISSESTEPSDNFEVQSL
TSQRECSKTVNTEALMTVFHPQNLETLNSKMLKEKMKEQSWKILFAECGRGVSMFRTKKT
RDLVVRGIPETLRGELWMLFSGAVNDMATNPDYYTEVVEQSLGTCNLATEEIERDLRRSL
PEHPAFQSDTGISALRRVLTAYAYRNPKIGYCQAMNILTSVLLLYAKEEEAFWLLVAVCE
RMLPDYFNRRIIGALVDQAVFEELIRDHLPQLTEHMTDMTFFSSVSLSWFLTLFISVLPI
ESAVNVVDCFFYDGIKAILQLGLAILDYNLDKLLTCKDDAEAVTALNRFFDNVTNKDSPL
PSNVQQGSNVSDEKTSHTRVDITDLIRESNEKYGNIRYEDIHSMRCRNRLYVIQTLEETT
KQNVLRVVSQDVKLSLQELDELYVIFKKELFLSCYWCLGCPVLKHHDPSLPYLEQYQIDC
QQFRALYHLLSPWAHSANKDSLALWTFRLLDENSDCLINFKEFSSAIDIMYNGSFTEKLK
LLFKLHIPPAYTEVKSKDASKGDELSKEELLYFSQLHVSKPANEKEAESAKHSPEKGKGK
IDIQAYLSQWQDELFKKEENIKDLPRMNQSQFIQFSKTLYNLFHEDPEEESLYQAIAVVT
SLLLRMEEVGRKLHSPTSSAKGFSGTVCGSGGPSEEKTGSHLEKDPCSFREEPQWSFAFE
QILASLLNEPALVRFFEKPIDVKAKLENARISQLRSRTKM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0R0W9	0.748	0.755	0.000	1108	0.637	0.644	B0R0W9.pdb.gz	TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio OX=7955 GN=tbc1d8b PE=1 SV=1
2	AFDB:Q0IIM8	1.000	1.000	0.000	1120	1.000	1.000	Q0IIM8.pdb.gz	TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens OX=9606 GN=TBC1D8B PE=1 SV=2
3	AFDB:O95759	0.868	0.853	3.030E-101	1140	0.543	0.533	O95759.pdb.gz	TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens OX=9606 GN=TBC1D8 PE=1 SV=3
4	AFDB:Q6ZT07	0.823	0.732	1.932E-94	1266	0.522	0.462	Q6ZT07.pdb.gz	TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens OX=9606 GN=TBC1D9 PE=2 SV=2
5	AFDB:Q66K14	0.823	0.741	9.765E-92	1250	0.531	0.476	Q66K14.pdb.gz	TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3
6	AFDB:O43048	0.490	0.642	1.031E-30	834	0.154	0.207	O43048.pdb.gz	YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC215.01 PE=3 SV=4
7	AFDB:P53258	0.486	0.565	4.092E-30	950	0.157	0.185	P53258.pdb.gz	GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDR1 PE=1 SV=1
8	AFDB:O94711	0.478	0.718	1.312E-28	720	0.158	0.246	O94711.pdb.gz	GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp2 PE=3 SV=1
9	AFDB:Q75JG4	0.324	0.365	1.202E-18	986	0.143	0.162	Q75JG4.pdb.gz	Q75JG4_DICDI RabGAP/TBC domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=cnrF PE=4 SV=1
10	AFDB:F1LJ00	0.226	0.304	5.801E-15	815	0.102	0.140	F1LJ00.pdb.gz	F1LJ00_HUMAN TBC1 domain family, member 18 OS=Homo sapiens OX=9606 GN=TBC1D18 PE=2 SV=1
11	PDB:6xtbE	0.079	0.353	5.496E-6	235	0.029	0.140	6xtbE.pdb.gz
12	PDB:7nkyQ	0.075	0.167	3.916E-5	404	0.042	0.116	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
13	PDB:5yqrA	0.087	0.350	6.201E-5	268	0.038	0.160	5yqrA.pdb.gz
14	PDB:1lw3A	0.087	0.183	2.462E-4	513	0.046	0.101	1lw3A.pdb.gz
15	PDB:3ljuX	0.101	0.225	1.205E-3	373	0.015	0.046	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
16	PDB:7c3mA	0.075	0.137	1.754E-3	577	0.038	0.075	7c3mA.pdb.gz
17	PDB:7nkyO	0.074	0.171	3.149E-3	427	0.025	0.066	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
18	PDB:1s1eA	0.122	0.607	6.407E-3	181	0.031	0.193	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
19	PDB:4mk0A	0.092	0.153	8.583E-3	631	0.021	0.038	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:5aanA	0.082	0.441	1.014E-2	183	0.024	0.148	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L3A9	0.0	1044	1232	0.500	0.455	A1L3A9_HUMAN TBC1 domain family, member 9B (With GRAM domain) OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=1
2	B0R0W9	0.0	1384	1108	0.642	0.649	TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio OX=7955 GN=tbc1d8b PE=1 SV=1
3	O95759	0.0	1161	1140	0.552	0.542	TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens OX=9606 GN=TBC1D8 PE=1 SV=3
4	Q0IIM8	0.0	2328	1120	1.000	1.000	TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens OX=9606 GN=TBC1D8B PE=1 SV=2
5	Q66K14	0.0	1045	1250	0.504	0.451	TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3
6	Q6ZT07	0.0	1060	1266	0.503	0.445	TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens OX=9606 GN=TBC1D9 PE=2 SV=2
7	P53258	4.87e-63	234	950	0.111	0.131	GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDR1 PE=1 SV=1
8	O43048	3.86e-55	209	834	0.101	0.135	YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC215.01 PE=3 SV=4
9	O94711	7.74e-53	200	720	0.129	0.200	GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp2 PE=3 SV=1
10	Q96HU1	4.11e-42	168	749	0.085	0.127	SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens OX=9606 GN=SGSM3 PE=1 SV=1
11	Q8VCZ6	4.06e-40	162	750	0.079	0.117	SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus OX=10090 GN=Sgsm3 PE=1 SV=1
12	P87234	1.74e-36	149	635	0.079	0.139	GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp3 PE=1 SV=1
13	A0A384L1W6	5.60e-35	139	353	0.080	0.255	A0A384L1W6_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At3g02460 PE=1 SV=1
14	Q9VGL8	8.65e-34	136	363	0.072	0.223	TBWKD_DROME TBC1 domain family member whacked OS=Drosophila melanogaster OX=7227 GN=wkd PE=1 SV=1
15	Q23419	3.74e-33	141	908	0.072	0.089	Q23419_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tbc-2 PE=1 SV=2
16	Q75JG4	1.67e-32	139	986	0.105	0.120	Q75JG4_DICDI RabGAP/TBC domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=cnrF PE=4 SV=1
17	Q12317	2.07e-32	135	492	0.071	0.161	MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSB4 PE=1 SV=1
18	Q9UPU7	2.45e-32	138	963	0.088	0.103	TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens OX=9606 GN=TBC1D2B PE=1 SV=2
19	Q8C9V1	2.87e-32	133	444	0.072	0.182	TB10C_MOUSE Carabin OS=Mus musculus OX=10090 GN=Tbc1d10c PE=1 SV=1
20	Q9BYX2	8.83e-32	136	928	0.071	0.085	TBD2A_HUMAN TBC1 domain family member 2A OS=Homo sapiens OX=9606 GN=TBC1D2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	79	14.2	EF hand
2	PF13499 EF-hand_7	4.2e+02	12.8	EF-hand domain pair
3	PF02893 GRAM	7.6e-28	108.1	GRAM domain
4	PF00566 RabGAP-TBC	5.9e-42	155.3	Rab-GTPase-TBC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349781

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360108	0.913	Putative tyrosine-protein phosphatase auxilin
2	9606.ENSP00000432083	0.901	Heat shock cognate 71 kDa protein
3	9606.ENSP00000429309	0.900	Belongs to the TPD52 family
4	9606.ENSP00000434142	0.900	Tumor protein D52 like 1
5	9606.ENSP00000396755	0.747	Cyclin N-terminal domain containing 2
6	9606.ENSP00000398744	0.719	Adenosine deaminase-like protein
7	9606.ENSP00000417573	0.712	Protein YIPF6
8	9606.ENSP00000479606	0.685	Clathrin heavy chain 1
9	9606.ENSP00000447053	0.665	Ras-related protein Rab-5C
10	9606.ENSP00000360154	0.661	Inositol polyphosphate 5-phosphatase OCRL-1
11	9606.ENSP00000256637	0.659	Sortilin
12	9606.ENSP00000265970	0.656	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
13	9606.ENSP00000314499	0.656	Cyclin-G-associated kinase
14	9606.ENSP00000440005	0.651	ADP-ribosylation factor 1
15	9606.ENSP00000350199	0.636	AP-1 complex subunit beta-1
16	9606.ENSP00000366998	0.632	Sorting nexin-5
17	9606.ENSP00000377015	0.632	Phosphatidylinositol-binding clathrin assembly protein
18	9606.ENSP00000377148	0.630	AP-1 complex subunit gamma-1
19	9606.ENSP00000255194	0.627	AP-3 complex subunit beta-1
20	9606.ENSP00000368831	0.627	Sorting nexin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.986	multicellular organismal process
GO:0006810	0.979	transport
GO:0003008	0.975	system process
GO:0016192	0.964	vesicle-mediated transport
GO:0097205	0.946	renal filtration
GO:0003094	0.845	glomerular filtration
GO:0065007	0.745	biological regulation
GO:0050794	0.597	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0016020	0.875	membrane
GO:0043226	0.469	organelle
GO:0012505	0.463	endomembrane system
GO:0043227	0.439	membrane-bounded organelle
GO:0043231	0.430	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]