StarFunc result for job id Q0P6H9

User Input

>input (643 residues)
MAAVLALRVVAGLAAAALVAMLLEHYGLAGQPSPLPRPAPPRRPHPAPGPGDSNIFWGLQ
ISDIHLSRFRDPGRAVDLEKFCSETIDIIQPALVLATGDLTDAKTKEQLGSRQHEVEWQT
YQGILKKTRVMEKTKWLDIKGNHDAFNIPSLDSIKNYYRKYSAVRRDGSFHYVHSTPFGN
YSFICVDATVNPGPKRPYNFFGILDKKKMEELLLLAKESSRSNHTIWFGHFTTSTILSPS
PGIRSIMSSAIAYLCGHLHTLGGLMPVLHTRHFQGTLELEVGDWKDNRRYRIFAFDHDLF
SFADLIFGKWPVVLITNPKSLLYSCGEHEPLERLLHSTHIRVLAFSLSSITSVTVKIDGV
HLGQAVHVSGPIFVLKWNPRNYSSGTHNIEVIVQDSAGRSKSVHHIFSVQENNHLSFDPL
ASFILRTDHYIMARVLFVLIVLSQLTILIIFRYRGYPELKEPSGFINLTSFSLHVLSKIN
IFYYSVLLLTLYTVLGPWFFGEIIDGKFGCCFSFGIFVNGHFLQGSITFIIGILQLAFFN
IPLMAYMCWSLLQRCFGHNFRSHLHQRKYLKIMPVHLLMLLLYIWQVYSCYFLYATYGTL
AFLFSPLRTWLTLLTPVLIRYVWTLNSTKFGIFMVQLKSHLSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3ib7A	0.311	0.635	8.014E-10	295	0.075	0.163	3ib7A.pdb.gz	A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability
2	PDB:2bq8X	0.292	0.569	3.930E-9	304	0.073	0.155	2bq8X.pdb.gz	Crystal Structures of Recombinant Human Purple Acid Phosphatase with and without an Inhibitory Conformation of the Repression Loop.
3	AFDB:P13686	0.290	0.528	4.287E-9	325	0.084	0.166	P13686.pdb.gz	PPA5_HUMAN Tartrate-resistant acid phosphatase type 5 OS=Homo sapiens OX=9606 GN=ACP5 PE=1 SV=3
4	AFDB:Q12212	0.290	0.299	2.337E-8	622	0.073	0.076	Q12212.pdb.gz	SIA1_YEAST Protein SIA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIA1 PE=2 SV=1
5	AFDB:P29288	0.317	0.577	3.387E-8	327	0.076	0.150	P29288.pdb.gz	PPA5_RAT Tartrate-resistant acid phosphatase type 5 OS=Rattus norvegicus OX=10116 GN=Acp5 PE=1 SV=1
6	PDB:2nxfA	0.307	0.594	4.268E-8	314	0.064	0.131	2nxfA.pdb.gz	Crystal Structure of a dimetal phosphatase from Danio rerio LOC 393393
7	AFDB:A0A2R8Q7Q3	0.297	0.547	5.755E-8	327	0.073	0.144	A0A2R8Q7Q3.pdb.gz
8	AFDB:Q53F39	0.271	0.421	5.755E-8	396	0.075	0.121	Q53F39.pdb.gz	MPPE1_HUMAN Metallophosphoesterase 1 OS=Homo sapiens OX=9606 GN=MPPE1 PE=1 SV=2
9	AFDB:O42841	0.277	0.400	1.031E-7	430	0.075	0.112	O42841.pdb.gz	YFH2_SCHPO Uncharacterized protein C23A1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23A1.02c PE=4 SV=2
10	PDB:5fibA	0.288	0.338	1.232E-7	534	0.076	0.092	5fibA.pdb.gz	Crystal structure of mammalian acid sphingomyelinase.
11	PDB:5jg8B	0.279	0.330	1.606E-7	530	0.087	0.106	5jg8B.pdb.gz	Structure of Human Acid Sphingomyelinase Reveals the Role of the Saposin Domain in Activating Substrate Hydrolysis.
12	PDB:5karA	0.277	0.408	2.728E-7	412	0.065	0.102	5karA.pdb.gz	Crystal Structure of the Acid Sphingomyelinase-like Phosphodiesterase SMPDL3B Provides Insights into Determinants of Substrate Specificity.
13	AFDB:Q92484	0.277	0.376	6.590E-7	453	0.067	0.095	Q92484.pdb.gz	ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a OS=Homo sapiens OX=9606 GN=SMPDL3A PE=1 SV=2
14	AFDB:A0A0B4LF50	0.240	0.401	1.622E-6	366	0.072	0.126	A0A0B4LF50.pdb.gz	A0A0B4LF50_DROME Metallophosphoesterase, isoform E OS=Drosophila melanogaster OX=7227 GN=Mppe PE=3 SV=1
15	PDB:5ebeA	0.264	0.383	1.939E-6	418	0.070	0.108	5ebeA.pdb.gz	The structure and catalytic mechanism of human sphingomyelin phosphodiesterase like 3a - an acid sphingomyelinase homologue with a novel nucleotide hydrolase activity.
16	PDB:3av0A	0.244	0.396	2.156E-6	369	0.070	0.122	3av0A.pdb.gz	Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
17	PDB:5fc1A	0.269	0.384	2.156E-6	426	0.065	0.099	5fc1A.pdb.gz	Structural Basis for Nucleotide Hydrolysis by the Acid Sphingomyelinase-like Phosphodiesterase SMPDL3A.
18	AFDB:P70158	0.275	0.383	2.907E-6	445	0.061	0.088	P70158.pdb.gz	ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a OS=Mus musculus OX=10090 GN=Smpdl3a PE=1 SV=2
19	AFDB:A0A0A0MR93	0.250	0.408	4.441E-6	374	0.079	0.136	A0A0A0MR93.pdb.gz	A0A0A0MR93_HUMAN Metallophosphoesterase 1 OS=Homo sapiens OX=9606 GN=MPPE1 PE=1 SV=1
20	PDB:3thoB	0.260	0.426	1.997E-5	366	0.068	0.120	3thoB.pdb.gz	ATP driven structural changes of the bacterial Mre11:Rad50 catalytic head complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q55D82	0.22	36.6	353	0.092	0.167	Q55D82_DICDI Calcineurin-like phosphoesterase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269754 PE=4 SV=1
2	Q57W00	0.74	35.4	1035	0.058	0.036	Q57W00_TRYB2 Transmembrane protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.670 PE=4 SV=1
3	Q5TZA2	0.74	35.4	2017	0.033	0.010	CROCC_HUMAN Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=2
4	Q57XU0	5.4	32.7	2395	0.025	0.007	Q57XU0_TRYB2 Sperm-tail PG-rich repeat OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.130 PE=4 SV=1
5	P13686	7.2	32.0	325	0.068	0.135	PPA5_HUMAN Tartrate-resistant acid phosphatase type 5 OS=Homo sapiens OX=9606 GN=ACP5 PE=1 SV=3
6	Q0E8U6	7.5	32.3	1504	0.030	0.013	Q0E8U6_DROME RE21455p OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=2 SV=1
7	Q9VQ54	8.3	32.0	1508	0.030	0.013	Q9VQ54_DROME FI05392p OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=2 SV=2
8	M9NE65	9.1	32.0	1554	0.030	0.012	M9NE65_DROME WD repeat domain 62, isoform F OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
9	A8DYT1	9.6	32.0	1539	0.030	0.012	A8DYT1_DROME WD repeat domain 62, isoform D OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19077 Big_13	32	16.4	Bacterial Ig-like domain
2	PF17957 Big_7	0.69	22.1	Bacterial Ig domain
3	PF00149 Metallophos	6.5e-06	38.3	Calcineurin-like phosphoesterase
4	PF08510 PIG-P	58	15.0	PIG-P

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260403

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000005286	0.570	Transmembrane protein 132A
2	9606.ENSP00000298351	0.570	Calcium permeable stress-gated cation channel 1
3	9606.ENSP00000336733	0.558	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
4	9606.ENSP00000322775	0.545	Inactive rhomboid protein 2
5	9606.ENSP00000452552	0.545	Zinc finger protein 37 homolog
6	9606.ENSP00000321343	0.535	Alpha-2,8-sialyltransferase 8E
7	9606.ENSP00000261475	0.531	Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
8	9606.ENSP00000354762	0.530	Cytochrome c oxidase assembly factor 3 homolog, mitochondrial
9	9606.ENSP00000270792	0.513	SH3 domain-binding glutamic acid-rich-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	0.997	catalytic activity
GO:0005515	0.996	protein binding
GO:0016787	0.980	hydrolase activity
GO:0016788	0.965	hydrolase activity, acting on ester bonds
GO:0042578	0.960	phosphoric ester hydrolase activity
GO:0046872	0.736	metal ion binding
GO:0016791	0.694	phosphatase activity
GO:0046914	0.572	transition metal ion binding
GO:0016740	0.560	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.987	primary metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0071704	0.986	organic substance metabolic process
GO:0044255	0.979	cellular lipid metabolic process
GO:0006643	0.974	membrane lipid metabolic process
GO:1901564	0.965	organonitrogen compound metabolic process
GO:0006793	0.927	phosphorus metabolic process
GO:0006664	0.882	glycolipid metabolic process
GO:0006650	0.826	glycerophospholipid metabolic process
GO:0046467	0.719	membrane lipid biosynthetic process
GO:0046488	0.682	phosphatidylinositol metabolic process
GO:0043170	0.550	macromolecule metabolic process
GO:0019538	0.505	protein metabolic process
GO:0044260	0.487	cellular macromolecule metabolic process
GO:0036211	0.419	protein modification process
GO:0050789	0.407	regulation of biological process
GO:1901566	0.302	organonitrogen compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0016020	0.995	membrane
GO:0012505	0.994	endomembrane system
GO:0031090	0.983	organelle membrane
GO:0005794	0.771	Golgi apparatus
GO:0031974	0.769	membrane-enclosed lumen
GO:0070013	0.761	intracellular organelle lumen
GO:0005783	0.549	endoplasmic reticulum
GO:0005789	0.405	endoplasmic reticulum membrane
GO:0031981	0.374	nuclear lumen
GO:0005654	0.307	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.980	Hydrolases.
EC:3.1.-.-	0.965	Acting on ester bonds.
EC:3.1.3.-	0.694	Phosphoric monoester hydrolases.
EC:2.-.-.-	0.560	Transferases.

[back to server]