StarFunc result for job id Q0PNE2

User Input

>input (266 residues)
MFVELNNLLNTTPDRAEQGKLTLLCDAKTDGSFLVHHFLSFYLKANCKVCFVALIQSFSH
YSIVGQKLGVSLTMARERGQLVFLEGLKSAVDVVFQAQKEPHPLQFLREANAGNLKPLFE
FVREALKPVDSGEARWTYPVLLVDDLSVLLSLGMGAVAVLDFIHYCRATVCWELKGNMVV
LVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRD
QSFTYQYKIQDKSVSFFAKGMSPAVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0PNE2	1.000	1.000	6.851E-59	266	1.000	1.000	Q0PNE2.pdb.gz	ELP6_HUMAN Elongator complex protein 6 OS=Homo sapiens OX=9606 GN=ELP6 PE=1 SV=1
2	AFDB:Q8BK75	0.977	0.977	3.879E-49	266	0.801	0.801	Q8BK75.pdb.gz	ELP6_MOUSE Elongator complex protein 6 OS=Mus musculus OX=10090 GN=Elp6 PE=1 SV=1
3	AFDB:Q8L9Y2	0.743	0.754	6.571E-19	262	0.256	0.260	Q8L9Y2.pdb.gz	ELP6_ARATH Elongator complex protein 6 OS=Arabidopsis thaliana OX=3702 GN=ELP6 PE=1 SV=1
4	AFDB:Q9NH01	0.760	0.801	3.076E-17	251	0.218	0.231	Q9NH01.pdb.gz	Q9NH01_DROME Elongator complex protein 6 OS=Drosophila melanogaster OX=7227 GN=Elp6 PE=2 SV=1
5	AFDB:O74385	0.716	0.761	1.344E-14	249	0.177	0.189	O74385.pdb.gz	ELP6_SCHPO Elongator complex protein 6 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elp6 PE=3 SV=1
6	AFDB:P74646	0.587	0.326	2.768E-11	519	0.109	0.056	P74646.pdb.gz	KAIC1_SYNY3 Circadian clock oscillator protein KaiC 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=kaiC1 PE=1 SV=1
7	PDB:4ejsC	0.637	0.626	3.407E-11	271	0.135	0.133	4ejsC.pdb.gz
8	AFDB:Q79PF4	0.568	0.317	1.153E-10	519	0.113	0.058	Q79PF4.pdb.gz	KAIC_SYNE7 Circadian clock oscillator protein KaiC OS=Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805) OX=1140 GN=kaiC PE=1 SV=1
9	AFDB:Q04868	0.642	0.627	2.583E-10	273	0.120	0.117	Q04868.pdb.gz	ELP6_YEAST Elongator complex protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ELP6 PE=1 SV=1
10	AFDB:Q6L8J9	0.586	0.327	3.522E-10	518	0.124	0.064	Q6L8J9.pdb.gz	KAIC_THEVL Circadian clock oscillator protein KaiC OS=Thermostichus vulcanus OX=32053 GN=kaiC PE=1 SV=1
11	AFDB:Q99L85	0.557	0.500	4.803E-10	300	0.165	0.147	Q99L85.pdb.gz	ELP5_MOUSE Elongator complex protein 5 OS=Mus musculus OX=10090 GN=Elp5 PE=2 SV=1
12	PDB:4dugA	0.569	0.325	5.222E-10	506	0.109	0.057	4dugA.pdb.gz	Dephosphorylation of the Core Clock Protein KaiC in the Cyanobacterial KaiABC Circadian Oscillator Proceeds via an ATP Synthase Mechanism.
13	PDB:4o0mA	0.569	0.333	8.061E-10	494	0.117	0.063	4o0mA.pdb.gz	An arginine tetrad as mediator of input-dependent and input-independent ATPases in the clock protein KaiC
14	PDB:5jwqA	0.562	0.384	1.806E-9	413	0.135	0.087	5jwqA.pdb.gz	Structural basis of the day-night transition in a bacterial circadian clock.
15	PDB:7dy1D	0.601	0.371	7.069E-9	458	0.132	0.076	7dy1D.pdb.gz	Regulation mechanisms of the dual ATPase in KaiC.
16	PDB:7v3xO	0.593	0.365	7.522E-9	461	0.113	0.065	7v3xO.pdb.gz	Elucidation of master allostery essential for circadian clock oscillation in cyanobacteria.
17	PDB:7v3xV	0.610	0.392	1.083E-7	437	0.120	0.073	7v3xV.pdb.gz	Elucidation of master allostery essential for circadian clock oscillation in cyanobacteria.
18	PDB:4nmnA	0.483	0.329	2.923E-7	425	0.158	0.099	4nmnA.pdb.gz	Nucleotide and partner-protein control of bacterial replicative helicase structure and function.
19	PDB:7t8bA	0.488	0.279	5.436E-7	519	0.128	0.066	7t8bA.pdb.gz
20	PDB:4esvC	0.521	0.344	8.393E-7	434	0.117	0.071	4esvC.pdb.gz	The Hexameric Helicase DnaB Adopts a Nonplanar Conformation during Translocation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0PNE2	0.0	550	266	1.000	1.000	ELP6_HUMAN Elongator complex protein 6 OS=Homo sapiens OX=9606 GN=ELP6 PE=1 SV=1
2	Q8BK75	7.52e-161	449	266	0.801	0.801	ELP6_MOUSE Elongator complex protein 6 OS=Mus musculus OX=10090 GN=Elp6 PE=1 SV=1
3	Q8L9Y2	3.06e-21	92.0	262	0.282	0.286	ELP6_ARATH Elongator complex protein 6 OS=Arabidopsis thaliana OX=3702 GN=ELP6 PE=1 SV=1
4	Q9NH01	3.26e-05	46.6	251	0.207	0.219	Q9NH01_DROME Elongator complex protein 6 OS=Drosophila melanogaster OX=7227 GN=Elp6 PE=2 SV=1
5	Q9VFW4	0.002	41.2	251	0.199	0.211	Q9VFW4_DROME Elongator complex protein 6 OS=Drosophila melanogaster OX=7227 GN=Elp6 PE=1 SV=1
6	O74385	0.004	40.0	249	0.180	0.193	ELP6_SCHPO Elongator complex protein 6 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elp6 PE=3 SV=1
7	Q7G192	0.32	35.0	1321	0.143	0.029	ALDO2_ARATH Indole-3-acetaldehyde oxidase OS=Arabidopsis thaliana OX=3702 GN=AAO2 PE=1 SV=2
8	Q9C7V5	4.0	31.2	552	0.071	0.034	PP104_ARATH Putative pentatricopeptide repeat-containing protein At1g64310 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E65 PE=3 SV=1
9	P46883	8.9	30.4	757	0.071	0.025	AMO_ECOLI Primary amine oxidase OS=Escherichia coli (strain K12) OX=83333 GN=tynA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09807 ELP6	1.7e-114	393.1	Elongation complex protein 6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296149

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379267	0.999	Elongator complex protein 4
2	9606.ENSP00000379869	0.998	Elongator complex protein 5
3	9606.ENSP00000256398	0.990	Elongator complex protein 3
4	9606.ENSP00000363779	0.989	Elongator complex protein 1
5	9606.ENSP00000414851	0.982	Elongator complex protein 2
6	9606.ENSP00000317721	0.877	Peroxisomal sarcosine oxidase
7	9606.ENSP00000388320	0.781	Cytoplasmic tRNA 2-thiolation protein 2
8	9606.ENSP00000376443	0.768	ATP-binding cassette sub-family A member 5
9	9606.ENSP00000360676	0.750	KTI12 chromatin associated homolog
10	9606.ENSP00000263094	0.737	ATP-binding cassette sub-family A member 7
11	9606.ENSP00000390011	0.733	Cytoplasmic tRNA 2-thiolation protein 1
12	9606.ENSP00000344155	0.721	ATP-binding cassette sub-family A member 2
13	9606.ENSP00000483688	0.700	Proteasome subunit beta type-3
14	9606.ENSP00000157812	0.694	26S proteasome regulatory subunit 6B
15	9606.ENSP00000310572	0.693	26S proteasome regulatory subunit 8
16	9606.ENSP00000223321	0.692	Proteasome subunit alpha type-2
17	9606.ENSP00000044462	0.689	Proteasome subunit alpha type-4
18	9606.ENSP00000216455	0.689	Proteasome subunit alpha type-3
19	9606.ENSP00000261479	0.689	Proteasome subunit alpha type-6
20	9606.ENSP00000270586	0.681	Proteasome subunit beta type-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.832	catalytic activity
GO:0097159	0.309	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0040012	0.994	regulation of locomotion
GO:0050794	0.987	regulation of cellular process
GO:0040017	0.979	positive regulation of locomotion
GO:0030334	0.975	regulation of cell migration
GO:2000147	0.973	positive regulation of cell motility
GO:0009987	0.720	cellular process
GO:0008152	0.681	metabolic process
GO:0071704	0.629	organic substance metabolic process
GO:0030335	0.525	positive regulation of cell migration
GO:0044237	0.519	cellular metabolic process
GO:0044238	0.508	primary metabolic process
GO:0006807	0.491	nitrogen compound metabolic process
GO:0043170	0.459	macromolecule metabolic process
GO:0034641	0.432	cellular nitrogen compound metabolic process
GO:1901360	0.425	organic cyclic compound metabolic process
GO:0046483	0.399	heterocycle metabolic process
GO:0006725	0.377	cellular aromatic compound metabolic process
GO:0006139	0.358	nucleobase-containing compound metabolic process
GO:0019222	0.307	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0033588	0.999	elongator holoenzyme complex
GO:0005654	0.952	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]