StarFunc result for job id Q0VD83

User Input

>input (1097 residues)
MDFLRLYLPGLHQALRGALDSLGTFVSYLLGDAVPTVEREAQAAEELGVVAVGKTGKIVE
EEAQEDLEGLRGSQNEGAGRLRGPGDDRRHEVGSSAVEQTWGWGDGSSHGSQAERQDSGA
GETAKAARCQEPSAHLEARKKSKAGSGACQDRSGQAQERQESHEQEVNREERLRSWEQEE
EEEEVRAREPGMARGAESEWTWHGETEGKAGAVGPKAAGDNREMEQGVREADAGETEEPG
AEGAGKGEEVVVVEKACESTRAWGTWGPGAEPEDWGILGREEARTTPGREEARAILDGEE
ARTISGGEEAETASGGEEAETASGGEEAGTASGGEEAGIASGGEAGTASGGEEAGTASGG
EEAGTASGGDEAWTTSGKEEADLLGVRQTEYGAVPGERLLEATGKVWVLEEEGDEEREAE
VSPFPKQPQVLGTERTEEAAESQTAGREAVGGQEAGESFEGQVDLRGKEAEMRQDLGIRA
DRARMEELVQAEEAQEERGSSRDPVAELPSDGEAEGTADLEATPEARPEEELTGEESEAA
QTSCGLLGVEWGGLTHSVTKGQGPELMGGAQTPTKQPEEREAGEVELMGVLALSKEEQER
SLEAGPRHAGSVKPEASEAFPGAWENRTRKDMERGNTQEDAADGEQREEEETAGGQTLAA
EAEGDRESELSEVPEAGGEGLTTQDAGCGTEEGEASVSENQELDGSTGADAGPCPSLGEA
YARETEDEEAEADRTSRRGWRLQAVAVGLPDREDAQTGSVAAGIMGGDVVPHISAAGAGE
ALEGVLGQGWDSKEKEEAAAGEHAGGQEFGLEGSAEEEVTGRGSQVEAFESREGGPWGGR
VEAEESAGAEDSCGLDPAGSQTARAEGMGAMVEAGGLLEKWTLLEEEAVGWQEREQREDS
EGRCGDYHPEGEAPRLLDAEGLMVTGGRRAEAKETEPESLEHVRGQEEQPTHQAPAEAAP
ESVGEAETAEAMGSARGGAANSWSEAPLPGSLLDVSVPRSRVHLSRSSSQRRSRPSFRRT
PAWEQQEEPPAPNPPEEELSAPEQRPLQLEEPLEPSPLRHDGTPVPARRRPLGHGFGLAH
PGMMQELQARLGRPKPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0VD83	0.999	0.999	0.000	1097	1.000	1.000	Q0VD83.pdb.gz	APOBR_HUMAN Apolipoprotein B receptor OS=Homo sapiens OX=9606 GN=APOBR PE=1 SV=3
2	AFDB:Q8VBT6	0.086	0.095	6.753E-38	942	0.427	0.497	Q8VBT6.pdb.gz	APOBR_MOUSE Apolipoprotein B receptor OS=Mus musculus OX=10090 GN=Apobr PE=1 SV=1
3	AFDB:O42854	0.039	0.032	1.838E-2	1611	0.131	0.089	O42854.pdb.gz	YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23A1.17 PE=1 SV=1
4	AFDB:Q9NZ56	0.037	0.027	3.789E-2	1722	0.159	0.101	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
5	AFDB:F1Q4W7	0.034	0.028	4.106E-2	1454	0.128	0.096	F1Q4W7.pdb.gz	F1Q4W7_DANRE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Danio rerio OX=7955 GN=dot1l PE=1 SV=2
6	AFDB:O00512	0.045	0.037	5.226E-2	1426	0.162	0.125	O00512.pdb.gz	BCL9_HUMAN B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4
7	AFDB:O94913	0.047	0.035	5.226E-2	1555	0.152	0.107	O94913.pdb.gz	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
8	AFDB:Q9QX47	0.044	0.026	1.371E-1	2444	0.146	0.065	Q9QX47.pdb.gz	SON_MOUSE Protein SON OS=Mus musculus OX=10090 GN=Son PE=1 SV=2
9	AFDB:Q7TSJ2	0.035	0.041	2.221E-1	906	0.143	0.173	Q7TSJ2.pdb.gz	MAP6_MOUSE Microtubule-associated protein 6 OS=Mus musculus OX=10090 GN=Map6 PE=1 SV=2
10	AFDB:Q63560	0.037	0.041	3.063E-1	952	0.154	0.178	Q63560.pdb.gz	MAP6_RAT Microtubule-associated protein 6 OS=Rattus norvegicus OX=10116 GN=Map6 PE=1 SV=1
11	PDB:7mqaSS	0.027	0.078	3.154	350	0.015	0.049	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7pksf	0.027	0.044	3.154	536	0.009	0.019	7pksf.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
13	PDB:4n78F	0.029	0.157	3.418	156	0.011	0.077	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
14	PDB:6ke6A8	0.030	0.051	4.014	548	0.015	0.029	6ke6A8.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
15	PDB:2jrxA	0.031	0.222	4.714	83	0.011	0.145	2jrxA.pdb.gz
16	PDB:7nfxy	0.026	0.127	6.502	147	0.008	0.061	7nfxy.pdb.gz	Receptor compaction and GTPase rearrangement drive SRP-mediated cotranslational protein translocation into the ER.
17	PDB:6c0fs	0.035	0.127	8.968	157	0.007	0.051	6c0fs.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
18	PDB:7pubCK	0.024	0.069	8.968	298	0.013	0.047	7pubCK.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
19	PDB:6hivCR	0.027	0.078	9.719	314	0.019	0.067	6hivCR.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:7c4jE	0.025	0.087	9.719	288	0.005	0.021	7c4jE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0VD83	0.0	2091	1097	1.000	1.000	APOBR_HUMAN Apolipoprotein B receptor OS=Homo sapiens OX=9606 GN=APOBR PE=1 SV=3
2	Q9NS13	0.0	2038	1076	0.976	0.995	Q9NS13_HUMAN Placenta apolipoprotein B48 receptor type 2 OS=Homo sapiens OX=9606 GN=APOB48R PE=2 SV=1
3	Q8VBT6	1.07e-89	311	942	0.295	0.344	APOBR_MOUSE Apolipoprotein B receptor OS=Mus musculus OX=10090 GN=Apobr PE=1 SV=1
4	Q12019	0.71	36.6	4910	0.061	0.014	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
5	Q8WQM0	3.9	34.3	1984	0.028	0.016	Q8WQM0_DROME Rho GTPase guanine nucleotide exchange factor GEF64C OS=Drosophila melanogaster OX=7227 GN=RhoGEF64C PE=2 SV=1
6	Q9VZ85	3.9	34.3	1984	0.028	0.016	Q9VZ85_DROME Rho guanine nucleotide exchange factor at 64C, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGEF64C PE=4 SV=2
7	Q95SH3	5.2	33.5	599	0.028	0.052	Q95SH3_DROME GH26207p OS=Drosophila melanogaster OX=7227 GN=RhoGEF64C PE=2 SV=1
8	C9E3B4	8.1	33.1	1566	0.015	0.011	C9E3B4_STRMG Surface protein adhesin OS=Streptococcus mutans OX=1309 GN=spaP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000457539

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233242	0.852	Apolipoprotein B-100
2	9606.ENSP00000454071	0.670	Low-density lipoprotein receptor
3	9606.ENSP00000252486	0.623	Apolipoprotein E
4	9606.ENSP00000321221	0.602	SH2B adapter protein 1
5	9606.ENSP00000465356	0.600	Apolipoprotein C-I
6	9606.ENSP00000468236	0.600	Apolipoprotein C-IV
7	9606.ENSP00000309757	0.593	Lipoprotein lipase
8	9606.ENSP00000363136	0.590	G-protein coupled receptor 3
9	9606.ENSP00000256592	0.587	Thyrotropin subunit beta
10	9606.ENSP00000317674	0.584	Apolipoprotein L1
11	9606.ENSP00000236850	0.583	Apolipoprotein A-I
12	9606.ENSP00000371532	0.583	Very low-density lipoprotein receptor
13	9606.ENSP00000365081	0.572	Apolipoprotein M
14	9606.ENSP00000200676	0.567	Cholesteryl ester transfer protein
15	9606.ENSP00000445002	0.563	Apolipoprotein A-V
16	9606.ENSP00000262101	0.561	Macrophage scavenger receptor types I and II
17	9606.ENSP00000322439	0.560	Elongation factor Tu, mitochondrial
18	9606.ENSP00000356969	0.558	Apolipoprotein A-II
19	9606.ENSP00000466775	0.558	Apolipoprotein C-II
20	9606.ENSP00000227667	0.556	Apolipoprotein C-III

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038024	1.000	cargo receptor activity
GO:0042803	1.000	protein homodimerization activity
GO:0030228	0.885	lipoprotein particle receptor activity
GO:0030229	0.595	very-low-density lipoprotein particle receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0006629	0.989	lipid metabolic process
GO:0044237	0.981	cellular metabolic process
GO:0046486	0.971	glycerolipid metabolic process
GO:0006638	0.933	neutral lipid metabolic process
GO:0006639	0.904	acylglycerol metabolic process
GO:0006641	0.875	triglyceride metabolic process
GO:0065007	0.795	biological regulation
GO:0050789	0.733	regulation of biological process
GO:0050794	0.690	regulation of cellular process
GO:0050896	0.345	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.926	intracellular anatomical structure
GO:0043226	0.798	organelle
GO:0043227	0.781	membrane-bounded organelle
GO:0043231	0.773	intracellular membrane-bounded organelle
GO:0005737	0.754	cytoplasm
GO:0070013	0.334	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]