StarFunc result for job id Q0VD86

User Input

>input (236 residues)
MQVQDDGVNLIPFAKCSRVVSRSPPPRLPSQSLRPMPQRYGDVFWKNLNQRPTPTWLEEQ
HIPPMLRATGCSQLGLYPPEQLPPPEMLWRRKKRRPCLEGMQQQGLGGVPARVRAVTYHL
EDLRRRQSIINELKKAQWGSSGAASEPVVLGEEGCGFPSTNEYPDLEEERATYPQEEDRF
LTPGRAQLLWSPWSPLDQEEACASRQLHSLASFSTVTARRNPLHNPWGMELAASEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0VD86	1.000	1.000	2.005E-38	236	1.000	1.000	Q0VD86.pdb.gz	INCA1_HUMAN Protein INCA1 OS=Homo sapiens OX=9606 GN=INCA1 PE=1 SV=1
2	AFDB:D3ZLG5	0.309	0.299	5.004E-21	249	0.610	0.578	D3ZLG5.pdb.gz	D3ZLG5_RAT Inhibitor of CDK, cyclin A1 interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Inca1 PE=4 SV=2
3	AFDB:Q6PKN7	0.228	0.231	7.231E-19	231	0.610	0.623	Q6PKN7.pdb.gz	INCA1_MOUSE Protein INCA1 OS=Mus musculus OX=10090 GN=Inca1 PE=1 SV=1
4	AFDB:Q9NTX9	0.158	0.106	1.200E-1	383	0.169	0.104	Q9NTX9.pdb.gz	F217B_HUMAN Protein FAM217B OS=Homo sapiens OX=9606 GN=FAM217B PE=1 SV=1
5	AFDB:E1BUG7	0.151	0.071	2.215E-1	690	0.131	0.045	E1BUG7.pdb.gz	SPT2_CHICK Protein SPT2 homolog OS=Gallus gallus OX=9031 GN=SPTY2D1 PE=1 SV=3
6	AFDB:D9YZV0	0.107	0.046	2.717E-1	684	0.148	0.051	D9YZV0.pdb.gz	D9YZV0_HUMAN HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L PE=1 SV=1
7	AFDB:P53407	0.157	0.111	3.113E-1	358	0.161	0.106	P53407.pdb.gz	ISL2B_DANRE Insulin gene enhancer protein isl-2b OS=Danio rerio OX=7955 GN=isl2b PE=2 SV=1
8	AFDB:Q940J1	0.124	0.104	3.333E-1	294	0.178	0.143	Q940J1.pdb.gz	ATB16_ARATH Homeobox-leucine zipper protein ATHB-16 OS=Arabidopsis thaliana OX=3702 GN=ATHB-16 PE=2 SV=2
9	AFDB:Q9LML2	0.150	0.043	3.333E-1	979	0.148	0.036	Q9LML2.pdb.gz	SMXL6_ARATH Protein SMAX1-LIKE 6 OS=Arabidopsis thaliana OX=3702 GN=SMXL6 PE=1 SV=1
10	AFDB:Q9UD71	0.119	0.133	3.819E-1	204	0.186	0.216	Q9UD71.pdb.gz	PPR1B_HUMAN Protein phosphatase 1 regulatory subunit 1B OS=Homo sapiens OX=9606 GN=PPP1R1B PE=1 SV=2
11	PDB:5datSM	0.132	0.179	5.514E-1	159	0.097	0.145	5datSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
12	PDB:4v88Ah	0.122	0.173	3.976	159	0.068	0.101	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
13	PDB:5dgeSM	0.130	0.182	4.557	159	0.081	0.119	5dgeSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
14	PDB:7btbm	0.117	0.071	4.878	469	0.081	0.041	7btbm.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
15	PDB:7oopV	0.089	0.096	6.406	217	0.093	0.101	7oopV.pdb.gz	Structural basis of human transcription-DNA repair coupling.
16	PDB:2p01A	0.120	0.095	7.341	323	0.081	0.059	2p01A.pdb.gz
17	PDB:6hivDH	0.090	0.047	9.005	564	0.127	0.053	6hivDH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
18	PDB:1rquA	0.074	0.129	9.640	120	0.034	0.067	1rquA.pdb.gz
19	PDB:7ajtCK	0.101	0.112	9.640	207	0.055	0.063	7ajtCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0VD86	1.31e-174	481	236	1.000	1.000	INCA1_HUMAN Protein INCA1 OS=Homo sapiens OX=9606 GN=INCA1 PE=1 SV=1
2	A0A8I6GGY4	7.19e-99	289	231	0.653	0.667	A0A8I6GGY4_RAT Inhibitor of CDK, cyclin A1 interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Inca1 PE=4 SV=1
3	D3ZLG5	1.46e-91	271	249	0.619	0.586	D3ZLG5_RAT Inhibitor of CDK, cyclin A1 interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Inca1 PE=4 SV=2
4	Q6PKN7	5.61e-91	269	231	0.610	0.623	INCA1_MOUSE Protein INCA1 OS=Mus musculus OX=10090 GN=Inca1 PE=1 SV=1
5	Q9I7U4	1.7	32.3	18141	0.093	0.001	TITIN_DROME Titin OS=Drosophila melanogaster OX=7227 GN=sls PE=1 SV=3
6	F1M6Q3	3.1	31.6	1707	0.110	0.015	F1M6Q3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=4
7	P06993	4.4	30.8	901	0.068	0.018	MALT_ECOLI HTH-type transcriptional regulator MalT OS=Escherichia coli (strain K12) OX=83333 GN=malT PE=1 SV=2
8	Q9HZZ1	4.7	30.8	376	0.093	0.059	EARP_PSEAE Protein-arginine rhamnosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=earP PE=1 SV=1
9	Q9U721	7.0	30.0	394	0.064	0.038	Q9U721_DROME Allatostatin A receptor 1, isoform B OS=Drosophila melanogaster OX=7227 GN=AstA-R1 PE=2 SV=1
10	P35331	9.0	30.0	1284	0.102	0.019	NRCAM_CHICK Neuronal cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15142 INCA1	2e-102	352.2	INCA1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000458316

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322142	0.853	Inhibitor of growth protein 5
2	9606.ENSP00000255465	0.832	Cyclin-A1
3	9606.ENSP00000356990	0.603	Kelch domain containing 9
4	9606.ENSP00000298546	0.561	Sperm acrosome-associated protein 9
5	9606.ENSP00000301039	0.558	Protein interacting with cyclin A1
6	9606.ENSP00000276816	0.536	Zinc finger protein 16
7	9606.ENSP00000277540	0.529	Diphthine methyltransferase
8	9606.ENSP00000266970	0.520	Cyclin-dependent kinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030332	1.000	cyclin binding
GO:0044877	0.999	protein-containing complex binding
GO:0042802	0.999	identical protein binding
GO:0004861	0.998	cyclin-dependent protein serine/threonine kinase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0080090	0.976	regulation of primary metabolic process
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0051726	0.971	regulation of cell cycle
GO:0051246	0.967	regulation of protein metabolic process
GO:0048523	0.956	negative regulation of cellular process
GO:0042325	0.915	regulation of phosphorylation
GO:0001932	0.903	regulation of protein phosphorylation
GO:0050790	0.880	regulation of catalytic activity
GO:0043549	0.813	regulation of kinase activity
GO:0000079	0.787	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0042326	0.779	negative regulation of phosphorylation
GO:0009987	0.765	cellular process
GO:0043086	0.760	negative regulation of catalytic activity
GO:0051248	0.723	negative regulation of protein metabolic process
GO:0006469	0.683	negative regulation of protein kinase activity
GO:0045786	0.616	negative regulation of cell cycle
GO:0071901	0.579	negative regulation of protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0016604	0.837	nuclear body
GO:0043232	0.787	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]