StarFunc result for job id Q0VDD8

User Input

>input (1400 residues)
MGRRSQWIWAMRCQMLVPVLSLHIGLARALGCGCIASKIECLIRCNAPFPLLDAVGSVAS
QELQSLTGTVGVTSGAAAYPRWNLARARAPPHLPGTQDPLRRVRDPTPIVASSPGRRRGS
WSGGYGQEASEPGVVGLCCAVLPIHPSLALAGVGGPDLRRFQEGPQRPSDHGAAEKHMET
FIPIDLTTENQEMDKEETKTKPRLLRYEEKKYEDVKPLETQPAEIAEKETLEYKTVRTFS
ESLKSEKTEEPKDDDVIRNIIRLREKLGWQTILPQHSLKYGSSKIAIQKITLKKPLEDDG
EFVYCLPRKSPKSLYNPYDLQVVSAHTAKHCKEFWVITASFISKLDSSRTYSLDEFCEEQ
LQQATQALKQLEDIRNKAISEMKSTFLKVAEKNEIKEYFESKLSEDDTTHFKLPKYRRLL
ETFFKFVMLVDYIFQELIRQLMNTAVTLLLELFNGSAGMPFSVEKKNENLIRTFKDNSFP
TGKTTNDCEELVDNSKLHAISVQKSEVKTDTDINEILNSVEVGKDLRKTYAPIFEVNLCL
RIPAESDSSENSKENFHESDQCPEECVMFEDEMSENKDNCVKKHSSEELLPKAKKSKEIS
YNLEDIISATITPLCQDPQLSIFIDLVSIMDLPNKTGSIIHYKEQTRWPDCHILFETDPA
YQNIIVNLLTIIGNSMGLVNAYSHKFIKYCTMTEKAKIMSMKISSMGELTSKEFEAILNR
FRNYFRHIVNMAIEKRIGIFNVVVESSLQQLECDPTEIEEFLEHFIFLNAISSKISKLEK
EFLTMSQLYSVAKHHQIHISEEQIAIFQVLLLKFSQLKSSMKLSKINKDTAITKFRDNLE
ACISGLHVDVGNLKAKIRTPLLLCAGTQVSTAMEMIQTLSGEAASLTNKAKAYSHYQDCF
SDSQSHMHSVNVEEITQIVLSEISDIEGDLTLRKKLWEAQEEWKRASWEWRNSSLQSIDV
ESVQRNVSKLMHIISVLEKEIYSIFIIPSIDDISAQLEESQVILATIKGSPHIGPIKSQI
MFYNDCVKSFVSSYSREKLEKVHAGLMCHLEEVADLVVLDTSNSRTKAILGALLILYVHC
RDIVINLLLKNIFNAEDFEWTRHLQYKWNEKQKLCYVSQGNASFTYGYEYLGCTSRLVIT
PLTDRCWLTLMEALHLNLGGCPAGPAGTGKTETVKDLAKCALFAFKCNTALIKLPNSLIV
LTCFGLEKTVLVMNTVMSFRFVLEGKEIRINMSCAVFITMNPRYGGGVELPDNLKSLFRP
VAMMVPHYQMIAEIILFSFGFKSANSLSGKLTNLYELARKQLSQQDHYNFGLRSLKIVLI
MAGTKKREFKCDTSDSLSEADETLIVIEAIREASLPKCPPEDVPLFENIIGDIFPEVTVL
KVNQLALEKVIYTATQQLGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7z8gA	0.240	0.114	1.500E-20	3047	0.129	0.059	7z8gA.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
2	PDB:5nugA	0.289	0.145	7.582E-20	2920	0.125	0.060	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
3	PDB:7z8fe	0.248	0.080	2.336E-19	4579	0.124	0.038	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
4	PDB:7mi6A	0.233	0.140	2.411E-17	2419	0.104	0.060	7mi6A.pdb.gz	Targeting allostery in the Dynein motor domain with small molecule inhibitors.
5	PDB:7kzmC	0.236	0.090	7.102E-17	3890	0.128	0.046	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
6	PDB:4w8fB	0.258	0.151	7.006E-15	2609	0.099	0.053	4w8fB.pdb.gz	Allosteric communication in the Dynein motor domain.
7	PDB:7mi8A	0.153	0.242	1.544E-11	868	0.065	0.105	7mi8A.pdb.gz
8	AFDB:Q0KI50	0.086	0.072	1.886E-7	1854	0.121	0.091	Q0KI50.pdb.gz	DMDD_DROME Dystrophin, isoform D OS=Drosophila melanogaster OX=7227 GN=Dys PE=1 SV=1
9	AFDB:R4GLV5	0.067	0.075	4.000E-5	1116	0.111	0.139	R4GLV5.pdb.gz
10	AFDB:Q9UPN4	0.038	0.046	4.377E-5	1083	0.104	0.134	Q9UPN4.pdb.gz	CP131_HUMAN Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3
11	AFDB:Q61595	0.043	0.045	1.178E-4	1327	0.121	0.128	Q61595.pdb.gz	KTN1_MOUSE Kinectin OS=Mus musculus OX=10090 GN=Ktn1 PE=1 SV=1
12	AFDB:Q9VMU5	0.040	0.063	1.233E-4	721	0.088	0.171	Q9VMU5.pdb.gz	QTC_DROME Protein quick-to-court OS=Drosophila melanogaster OX=7227 GN=qtc PE=2 SV=2
13	AFDB:A0A024R1Q0	0.051	0.061	3.798E-4	1141	0.105	0.129	A0A024R1Q0.pdb.gz
14	AFDB:Q69ZW3	0.048	0.053	5.205E-4	1231	0.081	0.092	Q69ZW3.pdb.gz	EHBP1_MOUSE EH domain-binding protein 1 OS=Mus musculus OX=10090 GN=Ehbp1 PE=1 SV=3
15	AFDB:A6XLD8	0.059	0.070	1.604E-3	1105	0.089	0.113	A6XLD8.pdb.gz	A6XLD8_DANRE Sterol regulatory element binding transcription factor 1 OS=Danio rerio OX=7955 GN=SREBF1 PE=2 SV=1
16	PDB:5jcss	0.133	0.095	2.745E-3	2003	0.030	0.021	5jcss.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
17	AFDB:Q08562	0.046	0.042	2.753E-3	1619	0.113	0.098	Q08562.pdb.gz	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1
18	AFDB:Q5SZL2	0.038	0.061	2.753E-3	805	0.077	0.134	Q5SZL2.pdb.gz	CE85L_HUMAN Centrosomal protein of 85 kDa-like OS=Homo sapiens OX=9606 GN=CEP85L PE=1 SV=1
19	PDB:7oxoA	0.113	0.187	1.327E-2	776	0.059	0.106	7oxoA.pdb.gz	Catalytic cycling of human mitochondrial Lon protease.
20	PDB:6fvtJ	0.103	0.282	1.452E-2	405	0.037	0.128	6fvtJ.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q8T7	4.65e-80	295	4250	0.116	0.038	DYH1_MOUSE Dynein axonemal heavy chain 1 OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1
2	E9Q0B6	6.89e-80	294	4144	0.111	0.037	E9Q0B6_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
3	Q9P2D7	1.81e-79	293	4265	0.115	0.038	DYH1_HUMAN Dynein axonemal heavy chain 1 OS=Homo sapiens OX=9606 GN=DNAH1 PE=1 SV=6
4	Q9SMH3	4.81e-76	282	4625	0.120	0.036	DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1
5	Q585U4	3.06e-74	276	4246	0.114	0.038	Q585U4_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.85 PE=4 SV=1
6	Q8WXX0	4.51e-74	276	4024	0.111	0.039	DYH7_HUMAN Dynein axonemal heavy chain 7 OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2
7	Q4AC22	1.35e-73	274	4149	0.114	0.039	Q4AC22_CHLRE Dynein heavy chain 9 OS=Chlamydomonas reinhardtii OX=3055 GN=DHC9 PE=1 SV=3
8	Q9VJC6	3.51e-72	270	4024	0.109	0.038	Q9VJC6_DROME Dynein heavy chain at 36C, isoform B OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=3 SV=2
9	A0A6H2EJG3	3.61e-72	270	4065	0.109	0.038	A0A6H2EJG3_DROME Dynein heavy chain at 36C, isoform C OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=3 SV=1
10	Q384K3	1.41e-71	268	4152	0.115	0.039	Q384K3_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0390 PE=4 SV=1
11	Q383F6	1.57e-71	268	4242	0.108	0.036	Q383F6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3010 PE=4 SV=1
12	E7FGT8	4.12e-71	266	4626	0.109	0.033	E7FGT8_DANRE Dynein heavy chain 10, axonemal OS=Danio rerio OX=7955 GN=si:dkeyp-86b9.1 PE=1 SV=2
13	F7ABZ6	7.97e-71	266	4534	0.105	0.032	F7ABZ6_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
14	D3YYQ8	8.00e-71	266	4591	0.105	0.032	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
15	P0C6F1	8.64e-71	265	4456	0.112	0.035	DYH2_MOUSE Dynein axonemal heavy chain 2 OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1
16	Q9TW74	5.24e-70	248	579	0.096	0.231	Q9TW74_DROME Dynein (Fragment) OS=Drosophila melanogaster OX=7227 GN=kl-5 PE=2 SV=1
17	B1AR51	1.18e-69	262	4484	0.100	0.031	B1AR51_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
18	Q57YY8	1.26e-69	262	4674	0.106	0.032	Q57YY8_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.260 PE=4 SV=1
19	Q9NYC9	2.74e-69	261	4486	0.100	0.031	DYH9_HUMAN Dynein axonemal heavy chain 9 OS=Homo sapiens OX=9606 GN=DNAH9 PE=1 SV=3
20	Q96DT5	3.56e-69	260	4516	0.096	0.030	DYH11_HUMAN Dynein axonemal heavy chain 11 OS=Homo sapiens OX=9606 GN=DNAH11 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12774 AAA_6	1.5e-81	285.6	Hydrolytic ATP binding site of dynein motor region
2	PF08393 DHC_N2	0.0078	27.0	Dynein heavy chain, N-terminal region 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 30611.ENSOGAP00000017300

Rank	PPI partner	STRING score	Description
1	30611.ENSOGAP00000003133	0.950	Dynactin 1
2	30611.ENSOGAP00000004683	0.943	Dynactin 2 (p50)
3	30611.ENSOGAP00000004984	0.866	Dynactin 5 (p25)
4	30611.ENSOGAP00000003207	0.860	Dynactin 6
5	30611.ENSOGAP00000004325	0.857	ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)
6	30611.ENSOGAP00000005629	0.857	ARP1 actin-related protein 1 homolog B, centractin beta (yeast)
7	30611.ENSOGAP00000008851	0.847	CAP-GLY domain containing linker protein family, member 4
8	30611.ENSOGAP00000009927	0.847	Dynactin 4 (p62)
9	30611.ENSOGAP00000007383	0.839	Dynactin 3 (p22)
10	30611.ENSOGAP00000006235	0.802	TBC1 domain family, member 31
11	30611.ENSOGAP00000000987	0.801	Platelet-activating factor acetylhydrolase IB subunit alpha
12	30611.ENSOGAP00000019093	0.756	Dynein, light chain, LC8-type 2
13	30611.ENSOGAP00000020833	0.756	Dynein, light chain, LC8-type 1
14	30611.ENSOGAP00000022581	0.756	Dynein, axonemal, light chain 4
15	30611.ENSOGAP00000000337	0.731	Uncharacterized protein
16	30611.ENSOGAP00000019985	0.731	Uncharacterized protein
17	30611.ENSOGAP00000011464	0.713	Dynein, cytoplasmic 2, light intermediate chain 1
18	30611.ENSOGAP00000002371	0.636	Kinesin-like protein
19	30611.ENSOGAP00000011880	0.630	Dynein, cytoplasmic 1, light intermediate chain 2
20	30611.ENSOGAP00000014474	0.630	Dynein, cytoplasmic 1, light intermediate chain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140657	0.997	ATP-dependent activity
GO:0003777	0.989	microtubule motor activity
GO:0003824	0.757	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007018	0.996	microtubule-based movement
GO:0000003	0.984	reproduction
GO:0022414	0.974	reproductive process
GO:0003341	0.726	cilium movement
GO:0032501	0.632	multicellular organismal process
GO:0032504	0.489	multicellular organism reproduction
GO:0019953	0.478	sexual reproduction
GO:0048609	0.465	multicellular organismal reproductive process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005622	0.995	intracellular anatomical structure
GO:0120025	0.984	plasma membrane bounded cell projection
GO:0005929	0.893	cilium
GO:0005737	0.830	cytoplasm
GO:0043229	0.644	intracellular organelle
GO:0043228	0.613	non-membrane-bounded organelle
GO:0043232	0.604	intracellular non-membrane-bounded organelle
GO:0032991	0.464	protein-containing complex
GO:0043231	0.458	intracellular membrane-bounded organelle
GO:0031514	0.306	motile cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]