StarFunc result for job id Q0VF49

User Input

>input (1180 residues)
MFTLSLLSRGHGKLGQDKQKLEVYFEPEDYLNWRSPEDYVPVSKPQDKNNASQHSWSLFL
PKTFSTRKGALILYSEGFAISAWTPKERRKGPYCPRGPWRKLDLELHTLQDLKEAILAYG
RQQGEQDRAWQPYLHFRSQLESQAQRQIQPGHSAKRYLRGLLRTWPPDAMYRLWCAGYIK
DSVLLQDSQLNVPKKLRPQQDLSGVPPKYHLLPVFPSFWIQQGKSFEQRQQGLDEGEAGA
AGHVDQGPLAKNHGSQGTRLPPRRKQPWQEDETQAEDTSIENHLCLYASKESYNEKTQQT
SRKAFGHGRIDHSWLPSDKSHITFCGGAFPNRKADLSDKQRNVKLHKARSSHLLQVLPAE
RSLFPPVASATGSRIITPGEVKKKKAPKALKLPPISEEPPRVLEPLKSQFKANEPPTELF
ILPVEIHYHTKQPPKEKAHRRGAPHPESEPESSEESTPVWRPPLKHASLETPWELTVHLP
VDASRDTLSPQGSSSLPPASLGNLTLKGSKARHTRVHSQGKGVWKGDDDAPPHDVAPPLD
LLPPIKGKKSPESQKGVDSPRTSDHNSPPSLPNMRVPRRALPAAQEDSSDPTLGHFLLGP
DGEKVCLSLPGHTQTEALPSGKAYESVNSNISHEEEGPSSQHFLKANTEPRANLHMNLYE
TSPLTQTTEKQGAQQSLEAAAQKTGEPQSCINKALICSNRKEFYTRKLHIDMTPFLKESG
NALDYQEEAGRPLRETHHNDQDPEPRSMTLDSPRASRTEHIQTPEADIVQKVGRDYDVHH
LHRGLLGYGPESPERLSAVYTSLLPREREGKAEPRLFSQETSANISHERDLINEAKRKEK
PKKDKTKGPKSEREGKVYGQAEAAIGKSKDSKAKKKLEKKTRPQRKRTQKERNLEIAAEL
SGPDVSYEETEDTSNRGSFASDSFVEDPWLSPKYDAQESQVSLDGRSSPSQIATVTGNME
SKEERRCEDPSKALLTKREQEKASWDRLRAERAEMRWLEVEKKRREQEEQRQLQQEQLER
AKKMEEELELEQQRRTEEIRLRKQRLQEEQQRQEEEERKQQLRLKAAQERARQQQEEFRR
KLRELQRKKQQEEAERAEAEKQRQEELEMQLEEEQKHLMEMAEEERLEYQRRKQEAEEKA
RLEAEERRQKEEEAARLALEEATKQAQEQARYWIFGQQLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4JD97	0.087	0.080	2.081E-2	1322	0.156	0.139	A0A0B4JD97.pdb.gz	A0A0B4JD97_DROME Transforming acidic coiled-coil protein, isoform K OS=Drosophila melanogaster OX=7227 GN=tacc PE=1 SV=1
2	AFDB:P23226	0.038	0.038	2.682E-2	1185	0.114	0.113	P23226.pdb.gz	MA205_DROME 205 kDa microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=Map205 PE=1 SV=2
3	AFDB:Q15032	0.046	0.048	3.926E-2	1099	0.125	0.135	Q15032.pdb.gz	R3HD1_HUMAN R3H domain-containing protein 1 OS=Homo sapiens OX=9606 GN=R3HDM1 PE=1 SV=3
4	AFDB:Q9VID4	0.049	0.051	8.408E-2	1119	0.098	0.104	Q9VID4.pdb.gz	Q9VID4_DROME LD38259p OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=2
5	AFDB:Q5T6F2	0.038	0.039	1.155E-1	1119	0.125	0.132	Q5T6F2.pdb.gz	UBAP2_HUMAN Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1
6	AFDB:Q9VQ58	0.040	0.043	1.155E-1	1023	0.114	0.132	Q9VQ58.pdb.gz	Q9VQ58_DROME FI15207p1 OS=Drosophila melanogaster OX=7227 GN=EMSY PE=1 SV=1
7	AFDB:P20676	0.040	0.043	1.311E-1	1076	0.097	0.106	P20676.pdb.gz	NUP1_YEAST Nucleoporin NUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP1 PE=1 SV=1
8	AFDB:Q6AI39	0.035	0.037	1.311E-1	1079	0.119	0.131	Q6AI39.pdb.gz	BICRL_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Homo sapiens OX=9606 GN=BICRAL PE=1 SV=2
9	AFDB:O94885	0.038	0.037	1.586E-1	1247	0.136	0.128	O94885.pdb.gz	SASH1_HUMAN SAM and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SASH1 PE=1 SV=3
10	AFDB:Q63560	0.043	0.052	2.044E-1	952	0.129	0.160	Q63560.pdb.gz	MAP6_RAT Microtubule-associated protein 6 OS=Rattus norvegicus OX=10116 GN=Map6 PE=1 SV=1
11	PDB:6r5kA	0.024	0.026	3.938	1040	0.014	0.015	6r5kA.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
12	PDB:5vhiC	0.017	0.047	4.471	350	0.008	0.026	5vhiC.pdb.gz
13	PDB:6qleP	0.019	0.085	5.076	242	0.004	0.021	6qleP.pdb.gz
14	PDB:7mq8LL	0.025	0.050	5.409	510	0.008	0.020	7mq8LL.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7fikB	0.018	0.033	5.763	598	0.006	0.012	7fikB.pdb.gz
16	PDB:3kq0A	0.015	0.099	6.543	175	0.003	0.017	3kq0A.pdb.gz	The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin.
17	PDB:6fecl	0.016	0.186	6.543	64	0.005	0.094	6fecl.pdb.gz	Structure of a human cap-dependent 48S translation pre-initiation complex.
18	PDB:7px0B	0.016	0.016	6.972	1253	0.003	0.003	7px0B.pdb.gz	Drosophila melanogaster's Aldehyde Oxidase 1: The First Invertebrate AOX structure
19	PDB:3a2fB	0.021	0.087	7.428	247	0.008	0.040	3a2fB.pdb.gz
20	PDB:3javA	0.031	0.023	7.428	2327	0.119	0.061	3javA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8DYA3	5.76e-07	56.6	3131	0.034	0.013	A8DYA3_DROME Toutatis, isoform E OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
2	A1Z8M2	6.46e-07	56.6	2999	0.034	0.013	A1Z8M2_DROME Toutatis, isoform A OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=2
3	P33332	3.05e-04	47.8	1336	0.036	0.031	SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC3 PE=1 SV=1
4	A2AUY4	0.002	45.1	2123	0.035	0.019	BAZ2B_MOUSE Bromodomain adjacent to zinc finger domain protein 2B OS=Mus musculus OX=10090 GN=Baz2b PE=1 SV=1
5	F4J0L7	0.002	45.1	2156	0.042	0.023	F4J0L7_ARATH Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=At3g50370 PE=1 SV=1
6	Q1MTN9	0.002	44.3	544	0.031	0.068	RLF2_SCHPO Chromatin assembly factor 1 subunit rlf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rlf2 PE=1 SV=2
7	M9ND00	0.004	43.9	1190	0.030	0.029	M9ND00_DROME Dynamin associated protein 160, isoform D OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
8	M9PBF6	0.004	43.9	1088	0.029	0.031	M9PBF6_DROME Dynamin associated protein 160, isoform G OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
9	M9PDC7	0.004	43.9	1005	0.029	0.034	M9PDC7_DROME Dynamin associated protein 160, isoform H OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
10	O61618	0.004	44.3	1094	0.029	0.031	O61618_DROME Dynamin associated protein isoform Dap160-1 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
11	O61639	0.004	43.9	1011	0.030	0.035	O61639_DROME Dynamin associated protein isoform Dap160-2 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
12	Q1WWC9	0.004	44.3	1096	0.029	0.031	Q1WWC9_DROME Dynamin associated protein 160, isoform C OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
13	Q8IDX6	0.004	44.3	3130	0.042	0.016	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
14	Q8INU2	0.004	43.9	1014	0.030	0.035	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
15	Q9VIF7	0.004	43.9	1097	0.029	0.031	Q9VIF7_DROME Dynamin associated protein 160, isoform A OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
16	Q9UIF8	0.006	43.5	2168	0.035	0.019	BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3
17	A0A0B4KFE3	0.007	43.5	3058	0.030	0.011	A0A0B4KFE3_DROME Toutatis, isoform F OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
18	Q9QZQ1	0.031	41.2	1820	0.049	0.032	AFAD_MOUSE Afadin OS=Mus musculus OX=10090 GN=Afdn PE=1 SV=3
19	Q386V6	0.048	40.0	568	0.046	0.095	Q386V6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.46.0004 PE=4 SV=1
20	O35889	0.056	40.4	1829	0.049	0.032	AFAD_RAT Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15709 DUF4670	3.9e-246	830.0	Domain of unknown function (DUF4670)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437957

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418695	0.972	Proteasome 26S subunit, non-ATPase 6
2	9606.ENSP00000401802	0.971	26S proteasome regulatory subunit 10B
3	9606.ENSP00000483688	0.971	Proteasome subunit beta type-3
4	9606.ENSP00000261479	0.966	Proteasome subunit alpha type-6
5	9606.ENSP00000362334	0.964	Proteasome subunit beta type-2
6	9606.ENSP00000290541	0.963	Proteasome subunit beta type-4
7	9606.ENSP00000157812	0.955	26S proteasome regulatory subunit 6B
8	9606.ENSP00000215071	0.955	26S proteasome non-ATPase regulatory subunit 8
9	9606.ENSP00000044462	0.954	Proteasome subunit alpha type-4
10	9606.ENSP00000310572	0.954	26S proteasome regulatory subunit 8
11	9606.ENSP00000391211	0.954	26S proteasome regulatory subunit 7
12	9606.ENSP00000414359	0.954	Proteasome subunit alpha type-1
13	9606.ENSP00000271308	0.953	Proteasome subunit alpha type-5
14	9606.ENSP00000262193	0.952	Proteasome subunit beta type-1
15	9606.ENSP00000219313	0.935	26S proteasome non-ATPase regulatory subunit 7
16	9606.ENSP00000396937	0.935	Proteasome 26S subunit, non-ATPase 13
17	9606.ENSP00000216455	0.927	Proteasome subunit alpha type-3
18	9606.ENSP00000481029	0.927	26S proteasome regulatory subunit 6A
19	9606.ENSP00000261303	0.923	26S proteasome regulatory subunit 4
20	9606.ENSP00000357879	0.917	26S proteasome non-ATPase regulatory subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.972	cellular process
GO:0065007	0.549	biological regulation
GO:0050789	0.519	regulation of biological process
GO:0032502	0.407	developmental process
GO:0050794	0.338	regulation of cellular process
GO:0071840	0.328	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.998	intracellular organelle
GO:0005737	0.991	cytoplasm
GO:0043231	0.965	intracellular membrane-bounded organelle
GO:0005634	0.937	nucleus
GO:0016020	0.353	membrane
GO:0005829	0.319	cytosol
GO:0043232	0.319	intracellular non-membrane-bounded organelle
GO:0070013	0.306	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]