StarFunc result for job id Q0VF96

User Input

>input (1302 residues)
MELYFGEYQHVQQEYGVHLRLASDDTQKSRSSQNSKAGSYGVSIRVQGIDGHPYIVLNNT
ERCLAGTSFSENGPPFPPPVINNLPLHSSNGSVPKENSEELQLPENPYAQPSPIRNLKQP
LLHEGKNGVLDRKDGSVKPSHLLNFQRHPELLQPYDPEKNELNLQNHQPSESNWLKTLTE
EGINNKKPWTCFPKPSNSQPTSPSLEDPAKSGVTAIRLCSSVVIEDPKKQTSVCVNVQSC
TKERVGEEALFTSGRPLTAHSPHAHPETKKTRPDVLPFRRQDSAGPVLDGARSRRSSSSS
TTPTSANSLYRFLLDDQECAIHADNVNRHENRRYIPFLPGTGRDIDTGSIPGVDQLIEKF
DQKPGLQRRGRSGKRNRINTDDRKRSRSVDSAFPFGLQGNSEYLIEFSRNLGKSSEHLLR
PSQVCPQRPLSQERRGKQSVGRTFAKLQGAAHGASCAHSRPPQPNIDGKVLETEGSQEST
VIRAPSLGAQSKKEEEVKTATATLMLQNRATATSPDSGAKKISVKTFPSASNTQATPDLL
KGQQELTQQTNEETAKQILYNYLKEGSTDNDDATKRKVNLVFEKIQTLKSRAAGSAQGNN
QACNSTSEVKDLLEQKSKLTIEVAELQRQLQLEVKNQQNIKEERERMRANLEELRSQHNE
KVEENSTLQQRLEESEGELRKNLEELFQVKMEREQHQTEIRDLQDQLSEMHDELDSAKRS
EDREKGALIEELLQAKQDLQDLLIAKEEQEDLLRKRERELTALKGALKEEVSSHDQEMDK
LKEQYDAELQALRESVEEATKNVEVLASRSNTSEQDQAGTEMRVKLLQEENEKLQGRSEE
LERRVAQLQRQIEDLKGDEAKAKETLKKYEGEIRQLEEALVHARKEEKEAVSARRALENE
LEAAQGNLSQTTQEQKQLSEKLKEESEQKEQLRRLKNEMENERWHLGKTIEKLQKEMADI
VEASRTSTLELQNQLDEYKEKNRRELAEMQRQLKEKTLEAEKSRLTAMKMQDEMRLMEEE
LRDYQRAQDEALTKRQLLEQTLKDLEYELEAKSHLKDDRSRLVKQMEDKVSQLEMELEEE
RNNSDLLSERISRSREQMEQLRNELLQERAARQDLECDKISLERQNKDLKSRIIHLEGSY
RSSKEGLVVQMEARIAELEDRLESEERDRANLQLSNRRLERKVKELVMQVDDEHLSLTDQ
KDQLSLRLKAMKRQVEEAEEEIDRLESSKKKLQRELEEQMDMNEHLQGQLNSMKKDLRLK
KLPSKVLDDMDDDDDLSTDGGSLYEAPVSYTFSKDSTVASQI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0VF96	1.000	1.000	0.000	1302	1.000	1.000	Q0VF96.pdb.gz	CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2
2	AFDB:Q6AW69	0.199	0.200	0.000	1298	0.826	0.828	Q6AW69.pdb.gz	CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus OX=10090 GN=Cgnl1 PE=1 SV=3
3	AFDB:Q9PTD7	0.093	0.090	1.894E-31	1360	0.296	0.284	Q9PTD7.pdb.gz	CING_XENLA Cingulin OS=Xenopus laevis OX=8355 GN=cgn PE=1 SV=3
4	AFDB:B9EK46	0.108	0.116	8.307E-29	1203	0.296	0.320	B9EK46.pdb.gz	B9EK46_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=1
5	AFDB:U3JAG9	0.105	0.120	8.127E-15	1113	0.169	0.198	U3JAG9.pdb.gz	CP131_DANRE Centrosomal protein of 131 kDa OS=Danio rerio OX=7955 GN=cep131 PE=1 SV=1
6	AFDB:Q9UPS8	0.096	0.075	1.291E-13	1710	0.155	0.118	Q9UPS8.pdb.gz	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
7	AFDB:Q62036	0.085	0.102	5.907E-13	1060	0.162	0.199	Q62036.pdb.gz	CP131_MOUSE Centrosomal protein of 131 kDa OS=Mus musculus OX=10090 GN=Cep131 PE=1 SV=2
8	AFDB:Q9UPN4	0.093	0.109	1.264E-12	1083	0.168	0.202	Q9UPN4.pdb.gz	CP131_HUMAN Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3
9	AFDB:I3L2J8	0.081	0.099	1.420E-11	1047	0.141	0.175	I3L2J8.pdb.gz	I3L2J8_HUMAN Centrosomal protein 131 OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=1
10	AFDB:Q6ZQ06	0.069	0.067	1.420E-11	1403	0.166	0.154	Q6ZQ06.pdb.gz	CE162_MOUSE Centrosomal protein of 162 kDa OS=Mus musculus OX=10090 GN=Cep162 PE=1 SV=2
11	PDB:6hivDD	0.028	0.039	1.016	791	0.019	0.032	6hivDD.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
12	PDB:7ajtUN	0.027	0.152	1.538	147	0.019	0.170	7ajtUN.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:7r5sS	0.037	0.327	1.892	120	0.015	0.158	7r5sS.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
14	PDB:7rroD	0.021	0.134	2.865	147	0.016	0.143	7rroD.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:7lswC	0.020	0.154	3.290	145	0.003	0.028	7lswC.pdb.gz
16	PDB:7c4jH	0.060	0.286	4.048	242	0.017	0.091	7c4jH.pdb.gz
17	PDB:7edxm	0.030	0.352	4.648	87	0.012	0.184	7edxm.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
18	PDB:6elzm	0.032	0.054	4.981	645	0.015	0.029	6elzm.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
19	PDB:7qsoC	0.023	0.098	5.720	210	0.003	0.019	7qsoC.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
20	PDB:6hivCb	0.034	0.129	6.129	252	0.012	0.060	6hivCb.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0VF96	0.0	2639	1302	1.000	1.000	CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2
2	Q6AW69	0.0	2042	1297	0.824	0.827	CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus OX=10090 GN=Cgnl1 PE=1 SV=3
3	Q9P2M7	1.03e-100	350	1203	0.200	0.216	CING_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=3
4	B9EK46	1.20e-100	350	1203	0.200	0.216	B9EK46_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=1
5	P59242	2.12e-97	341	1191	0.194	0.212	CING_MOUSE Cingulin OS=Mus musculus OX=10090 GN=Cgn PE=1 SV=1
6	Q9PTD7	1.33e-95	338	1368	0.202	0.192	CING_XENLA Cingulin OS=Xenopus laevis OX=8355 GN=cgn PE=1 SV=3
7	P10587	1.49e-31	137	1979	0.141	0.093	MYH11_CHICK Myosin-11 OS=Gallus gallus OX=9031 GN=MYH11 PE=1 SV=4
8	A6QLN6	2.32e-28	127	1972	0.161	0.106	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
9	Q4U0S2	1.94e-27	124	1974	0.145	0.096	Q4U0S2_DANRE Myosin-11 OS=Danio rerio OX=7955 GN=myh11 PE=1 SV=1
10	Q99323	2.25e-27	124	2057	0.152	0.096	MYSN_DROME Myosin heavy chain, non-muscle OS=Drosophila melanogaster OX=7227 GN=zip PE=1 SV=2
11	P35579	5.91e-27	122	1960	0.119	0.079	MYH9_HUMAN Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4
12	Q258K2	2.14e-26	120	1960	0.120	0.080	MYH9_CANLF Myosin-9 OS=Canis lupus familiaris OX=9615 GN=MYH9 PE=2 SV=1
13	P35749	7.95e-26	118	1972	0.064	0.042	MYH11_HUMAN Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3
14	Q8VDD5	2.01e-25	117	1960	0.117	0.078	MYH9_MOUSE Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 PE=1 SV=4
15	P35748	2.20e-25	117	1972	0.063	0.042	MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus OX=9986 GN=MYH11 PE=2 SV=2
16	Q61879	1.49e-24	114	1976	0.139	0.092	MYH10_MOUSE Myosin-10 OS=Mus musculus OX=10090 GN=Myh10 PE=1 SV=2
17	G3V9Y1	2.00e-24	114	1986	0.139	0.091	G3V9Y1_RAT Myosin heavy chain 10 OS=Rattus norvegicus OX=10116 GN=Myh10 PE=1 SV=2
18	Q9JLT0	3.46e-24	113	1976	0.139	0.092	MYH10_RAT Myosin-10 OS=Rattus norvegicus OX=10116 GN=Myh10 PE=1 SV=1
19	F1R3G4	3.91e-24	113	1992	0.137	0.090	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
20	I3ISA3	5.07e-24	112	1986	0.137	0.090	I3ISA3_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08386 Abhydrolase_4	2e+02	13.5	TAP-like protein
2	PF10046 BLOC1_2	6.5	18.5	Biogenesis of lysosome-related organelles complex-1 subunit 2
3	PF01576 Myosin_tail_1	2.4e-49	179.8	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281282

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354837	0.967	Rho guanine nucleotide exchange factor 2
2	9606.ENSP00000281537	0.921	Tight junction protein ZO-1
3	9606.ENSP00000308753	0.908	Tropomodulin-3
4	9606.ENSP00000249700	0.765	Tropomodulin-2
5	9606.ENSP00000347883	0.765	Pleckstrin homology domain-containing family A member 7
6	9606.ENSP00000379683	0.728	Aromatase
7	9606.ENSP00000287916	0.700	Claudin-12
8	9606.ENSP00000471635	0.671	Uncharacterized protein
9	9606.ENSP00000286827	0.584	T-lymphoma invasion and metastasis-inducing protein 1
10	9606.ENSP00000352995	0.549	Rho guanine nucleotide exchange factor 18
11	9606.ENSP00000320239	0.537	Transient receptor potential cation channel subfamily M member 7
12	9606.ENSP00000378577	0.536	Claudin-3
13	9606.ENSP00000278949	0.527	Myelin protein zero-like protein 3
14	9606.ENSP00000352264	0.514	CD2-associated protein
15	9606.ENSP00000323264	0.502	MARVEL domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.344	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.989	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0030036	0.978	actin cytoskeleton organization
GO:0048523	0.945	negative regulation of cellular process
GO:0051128	0.916	regulation of cellular component organization
GO:0032970	0.882	regulation of actin filament-based process
GO:0051179	0.877	localization
GO:0051493	0.877	regulation of cytoskeleton organization
GO:0044087	0.853	regulation of cellular component biogenesis
GO:0051641	0.643	cellular localization
GO:0097435	0.464	supramolecular fiber organization
GO:0032956	0.464	regulation of actin cytoskeleton organization
GO:0023051	0.460	regulation of signaling
GO:0010646	0.460	regulation of cell communication
GO:0048583	0.445	regulation of response to stimulus
GO:0032502	0.437	developmental process
GO:0048856	0.432	anatomical structure development
GO:0007015	0.385	actin filament organization
GO:1902903	0.368	regulation of supramolecular fiber organization
GO:0009966	0.362	regulation of signal transduction
GO:0051494	0.357	negative regulation of cytoskeleton organization
GO:0032501	0.343	multicellular organismal process
GO:0051056	0.341	regulation of small GTPase mediated signal transduction
GO:0048518	0.338	positive regulation of biological process
GO:0048522	0.320	positive regulation of cellular process
GO:0050896	0.314	response to stimulus
GO:0008104	0.305	protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.995	intracellular anatomical structure
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0032991	0.986	protein-containing complex
GO:0070161	0.973	anchoring junction
GO:0005911	0.964	cell-cell junction
GO:0071944	0.948	cell periphery
GO:0005886	0.938	plasma membrane
GO:0005856	0.890	cytoskeleton
GO:0043296	0.876	apical junction complex
GO:0070160	0.863	tight junction
GO:0005737	0.819	cytoplasm
GO:0043231	0.733	intracellular membrane-bounded organelle
GO:0015629	0.677	actin cytoskeleton
GO:0005923	0.450	bicellular tight junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]