StarFunc result for job id Q0VGL1

User Input

>input (99 residues)
MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMN
VPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0VGL1	1.000	1.000	2.017E-18	99	1.000	1.000	Q0VGL1.pdb.gz	LTOR4_HUMAN Ragulator complex protein LAMTOR4 OS=Homo sapiens OX=9606 GN=LAMTOR4 PE=1 SV=1
2	PDB:5y39D	0.896	0.896	5.104E-15	99	0.990	0.990	5y39D.pdb.gz
3	AFDB:Q9VZL6	0.776	0.651	1.891E-7	120	0.283	0.233	Q9VZL6.pdb.gz	LTOR4_DROME Ragulator complex protein LAMTOR4 homolog OS=Drosophila melanogaster OX=7227 GN=Lamtor4 PE=1 SV=2
4	AFDB:Q22752	0.728	0.755	6.153E-5	95	0.141	0.147	Q22752.pdb.gz	Q22752_CAEEL Dynein light chain roadblock OS=Caenorhabditis elegans OX=6239 GN=dyrb-1 PE=1 SV=1
5	PDB:3ms6A	0.716	0.771	8.146E-5	91	0.182	0.198	3ms6A.pdb.gz
6	AFDB:Q7KMS3	0.777	0.791	8.265E-5	97	0.202	0.206	Q7KMS3.pdb.gz	Q7KMS3_DROME Dynein light chain roadblock OS=Drosophila melanogaster OX=7227 GN=robl PE=1 SV=1
7	AFDB:O96824	0.591	0.586	9.867E-5	100	0.182	0.180	O96824.pdb.gz	O96824_DROME Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5 OS=Drosophila melanogaster OX=7227 GN=Lamtor5 PE=1 SV=1
8	AFDB:Q57YQ2	0.759	0.658	9.867E-5	116	0.192	0.164	Q57YQ2.pdb.gz	Q57YQ2_TRYB2 Dynein light chain 2B, cytoplasmic, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.860 PE=3 SV=1
9	AFDB:Q38D18	0.761	0.768	1.110E-4	98	0.172	0.173	Q38D18.pdb.gz	Q38D18_TRYB2 Dynein light chain roadblock OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4920 PE=3 SV=1
10	PDB:3l9kA	0.712	0.739	1.559E-4	95	0.172	0.179	3l9kA.pdb.gz
11	PDB:6b9xB	0.672	0.547	1.654E-4	126	0.212	0.167	6b9xB.pdb.gz
12	AFDB:Q7ZUX8	0.737	0.758	1.780E-4	96	0.162	0.167	Q7ZUX8.pdb.gz	Q7ZUX8_DANRE Dynein light chain roadblock OS=Danio rerio OX=7955 GN=DNCL2A PE=1 SV=1
13	AFDB:O43504	0.728	0.784	2.255E-4	91	0.192	0.209	O43504.pdb.gz	LTOR5_HUMAN Ragulator complex protein LAMTOR5 OS=Homo sapiens OX=9606 GN=LAMTOR5 PE=1 SV=1
14	AFDB:Q8TF09	0.738	0.759	2.255E-4	96	0.152	0.156	Q8TF09.pdb.gz	DLRB2_HUMAN Dynein light chain roadblock-type 2 OS=Homo sapiens OX=9606 GN=DYNLRB2 PE=1 SV=1
15	PDB:6izwB	0.745	0.530	3.563E-4	145	0.202	0.138	6izwB.pdb.gz	Allosteric regulation of a prokaryotic small Ras-like GTPase contributes to cell polarity oscillations in bacterial motility.
16	PDB:7kzmI	0.659	0.638	6.430E-4	103	0.212	0.204	7kzmI.pdb.gz	Structure of a microtubule-bound axonemal dynein.
17	PDB:3t1rC	0.674	0.511	9.162E-4	136	0.141	0.103	3t1rC.pdb.gz	Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
18	PDB:1y4oA	0.752	0.720	1.031E-3	104	0.152	0.144	1y4oA.pdb.gz
19	PDB:4xpmB	0.550	0.784	1.031E-3	67	0.091	0.134	4xpmB.pdb.gz
20	PDB:5x6uA	0.562	0.468	1.861E-3	124	0.101	0.081	5x6uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0VGL1	2.16e-68	201	99	1.000	1.000	LTOR4_HUMAN Ragulator complex protein LAMTOR4 OS=Homo sapiens OX=9606 GN=LAMTOR4 PE=1 SV=1
2	Q9VZL6	1.14e-09	53.1	120	0.263	0.217	LTOR4_DROME Ragulator complex protein LAMTOR4 homolog OS=Drosophila melanogaster OX=7227 GN=Lamtor4 PE=1 SV=2
3	O94213	0.84	30.4	475	0.263	0.055	TPS1_PICAN Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Pichia angusta OX=870730 GN=TPS1 PE=1 SV=1
4	Q9USZ2	1.6	29.6	955	0.182	0.019	YNR7_SCHPO Uncharacterized protein C11G11.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC11G11.07 PE=4 SV=2
5	F8W0U9	6.4	28.1	1522	0.253	0.016	F8W0U9_HUMAN NACHT and WD repeat domain containing 1 OS=Homo sapiens OX=9606 GN=NWD1 PE=1 SV=1
6	D4A0Y6	6.6	28.1	3121	0.152	0.005	D4A0Y6_RAT Marker of proliferation Ki-67 OS=Rattus norvegicus OX=10116 GN=Mki67 PE=1 SV=3
7	J9VP90	9.0	27.7	824	0.152	0.018	J9VP90_CRYNH Protein SEY1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=SEY1 PE=3 SV=2
8	P28006	9.8	27.3	793	0.162	0.020	GAC1_YEAST Serine/threonine-protein phosphatase 1 regulatory subunit GAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAC1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343118

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256644	0.999	Ragulator complex protein LAMTOR5
2	9606.ENSP00000262850	0.999	Ras-related GTP-binding protein B
3	9606.ENSP00000278671	0.999	Ragulator complex protein LAMTOR1
4	9606.ENSP00000307272	0.999	Regulatory-associated protein of mTOR
5	9606.ENSP00000357288	0.999	Ragulator complex protein LAMTOR2
6	9606.ENSP00000362092	0.999	Ras-related GTP-binding protein C
7	9606.ENSP00000369899	0.999	Ras-related GTP-binding protein A
8	9606.ENSP00000380074	0.999	Sodium-coupled neutral amino acid transporter 9
9	9606.ENSP00000424183	0.999	Ragulator complex protein LAMTOR3
10	9606.ENSP00000285071	0.988	Folliculin
11	9606.ENSP00000358423	0.985	Ras-related GTP-binding protein D
12	9606.ENSP00000264433	0.984	Folliculin-interacting protein 2
13	9606.ENSP00000354558	0.976	Serine/threonine-protein kinase mTOR
14	9606.ENSP00000232501	0.966	GATOR complex protein NPRL2
15	9606.ENSP00000293883	0.954	GATOR complex protein WDR24
16	9606.ENSP00000339881	0.954	GATOR complex protein MIOS
17	9606.ENSP00000262144	0.953	GATOR complex protein WDR59
18	9606.ENSP00000483814	0.953	GATOR complex protein NPRL3
19	9606.ENSP00000383105	0.950	GATOR complex protein DEPDC5
20	9606.ENSP00000384183	0.949	Cytosolic arginine sensor for mTORC1 subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0060090	1.000	molecular adaptor activity
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.993	cellular response to stimulus
GO:0032008	0.990	positive regulation of TOR signaling
GO:0010243	0.989	response to organonitrogen compound
GO:0033036	0.986	macromolecule localization
GO:0051641	0.986	cellular localization
GO:0009719	0.985	response to endogenous stimulus
GO:0071230	0.981	cellular response to amino acid stimulus
GO:0033365	0.977	protein localization to organelle
GO:0071840	0.951	cellular component organization or biogenesis
GO:0061462	0.951	protein localization to lysosome
GO:0090066	0.939	regulation of anatomical structure size
GO:0016043	0.939	cellular component organization
GO:0008361	0.890	regulation of cell size

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098796	0.999	membrane protein complex
GO:0005765	0.997	lysosomal membrane
GO:0032045	0.996	guanyl-nucleotide exchange factor complex
GO:0005829	0.392	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]