StarFunc result for job id Q0Z7S8

User Input

>input (132 residues)
MVEPFLGTWKLVSSENFEDYMKELGVNFAARNMAGLVKPTVTISVDGKMMTIRTESSFQD
TKISFKLGEEFDETTADNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEKMVVECKM
NNIVSTRIYEKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0Z7S8	1.000	1.000	5.086E-23	132	1.000	1.000	Q0Z7S8.pdb.gz	FABP9_HUMAN Fatty acid-binding protein 9 OS=Homo sapiens OX=9606 GN=FABP9 PE=1 SV=1
2	PDB:4a60A	0.975	0.913	8.627E-21	141	0.985	0.922	4a60A.pdb.gz
3	AFDB:A0A0K0MJN3	0.993	0.993	4.523E-19	132	0.636	0.636	A0A0K0MJN3.pdb.gz	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
4	AFDB:P02689	0.992	0.992	1.140E-18	132	0.674	0.674	P02689.pdb.gz	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
5	AFDB:O97788	0.988	0.988	1.200E-18	132	0.644	0.644	O97788.pdb.gz	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
6	AFDB:P07483	0.996	0.989	1.906E-18	133	0.553	0.549	P07483.pdb.gz	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
7	AFDB:F1MHQ4	0.991	0.991	2.875E-18	132	0.606	0.606	F1MHQ4.pdb.gz	F1MHQ4_BOVIN Fatty acid binding protein 4, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=3 SV=2
8	AFDB:P05413	0.997	0.990	4.119E-18	133	0.553	0.549	P05413.pdb.gz	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
9	AFDB:P24526	0.991	0.991	5.902E-18	132	0.659	0.659	P24526.pdb.gz	MYP2_MOUSE Myelin P2 protein OS=Mus musculus OX=10090 GN=Pmp2 PE=2 SV=2
10	PDB:3nr3A	0.995	0.973	7.221E-18	135	0.667	0.652	3nr3A.pdb.gz
11	PDB:3p6dA	0.974	0.926	1.035E-17	139	0.629	0.597	3p6dA.pdb.gz	Structural analysis of ibuprofen binding to human adipocyte fatty-acid binding protein (FABP4).
12	AFDB:P04117	0.986	0.986	1.093E-17	132	0.629	0.629	P04117.pdb.gz	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
13	AFDB:P55054	0.989	0.989	2.025E-17	132	0.682	0.682	P55054.pdb.gz	FABP9_RAT Fatty acid-binding protein 9 OS=Rattus norvegicus OX=10116 GN=Fabp9 PE=1 SV=1
14	PDB:7yf1A	0.983	0.975	2.891E-17	133	0.545	0.541	7yf1A.pdb.gz
15	PDB:5hz9A	0.986	0.964	3.737E-17	135	0.545	0.533	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
16	PDB:2qm9A	0.960	0.912	3.934E-17	139	0.621	0.590	2qm9A.pdb.gz	Structural Basis for Activation of Fatty Acid-binding Protein 4
17	PDB:5bvsA	0.955	0.955	2.501E-16	132	0.636	0.636	5bvsA.pdb.gz	Structural basis for the ligand-binding specificity of fatty acid-binding proteins (pFABP4 and pFABP5) in gentoo penguin
18	PDB:7e25A	0.978	0.930	4.633E-16	139	0.523	0.496	7e25A.pdb.gz	Crystal structure of human brain-type fatty acid-binding protein FABP7 complexed with palmitic acid.
19	PDB:4azqA	0.977	0.949	1.762E-15	136	0.492	0.478	4azqA.pdb.gz	Crystallographic Study of Fabp5 as an Intracellular Endocannabinoid Transporter.
20	PDB:5ur9F	0.932	0.893	1.604E-14	138	0.508	0.486	5ur9F.pdb.gz	The Antinociceptive Agent SBFI-26 Binds to Anandamide Transporters FABP5 and FABP7 at Two Different Sites.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0Z7S8	3.32e-94	269	132	1.000	1.000	FABP9_HUMAN Fatty acid-binding protein 9 OS=Homo sapiens OX=9606 GN=FABP9 PE=1 SV=1
2	P55054	1.00e-64	194	132	0.682	0.682	FABP9_RAT Fatty acid-binding protein 9 OS=Rattus norvegicus OX=10116 GN=Fabp9 PE=1 SV=1
3	O97788	6.45e-63	190	132	0.644	0.644	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
4	P02689	2.32e-61	186	132	0.674	0.674	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
5	A0A0K0MJN3	2.68e-61	186	132	0.636	0.636	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
6	P15090	1.71e-60	184	132	0.636	0.636	FABP4_HUMAN Fatty acid-binding protein, adipocyte OS=Homo sapiens OX=9606 GN=FABP4 PE=1 SV=3
7	F1MHQ4	3.97e-60	183	132	0.606	0.606	F1MHQ4_BOVIN Fatty acid binding protein 4, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=3 SV=2
8	P48035	1.46e-59	181	132	0.598	0.598	FABP4_BOVIN Fatty acid-binding protein, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=2 SV=2
9	P24526	1.88e-59	181	132	0.659	0.659	MYP2_MOUSE Myelin P2 protein OS=Mus musculus OX=10090 GN=Pmp2 PE=2 SV=2
10	P04117	4.24e-59	180	132	0.629	0.629	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
11	P70623	2.70e-57	176	132	0.606	0.606	FABP4_RAT Fatty acid-binding protein, adipocyte OS=Rattus norvegicus OX=10116 GN=Fabp4 PE=1 SV=3
12	P05413	2.90e-52	163	133	0.553	0.549	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
13	P07483	3.61e-52	163	133	0.553	0.549	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
14	P11404	7.78e-52	162	133	0.553	0.549	FABPH_MOUSE Fatty acid-binding protein, heart OS=Mus musculus OX=10090 GN=Fabp3 PE=1 SV=5
15	A6NFH5	6.81e-49	155	140	0.568	0.536	FBP12_HUMAN Fatty acid-binding protein 12 OS=Homo sapiens OX=9606 GN=FABP12 PE=2 SV=2
16	Q8UVG7	2.59e-48	153	133	0.538	0.534	Q8UVG7_DANRE Fatty acid-binding protein 3, muscle and heart OS=Danio rerio OX=7955 GN=H-FABP PE=1 SV=1
17	Q05423	1.84e-47	151	132	0.538	0.538	FABP7_CHICK Fatty acid-binding protein, brain OS=Gallus gallus OX=9031 GN=FABP7 PE=2 SV=2
18	O15540	4.23e-47	150	132	0.530	0.530	FABP7_HUMAN Fatty acid-binding protein, brain OS=Homo sapiens OX=9606 GN=FABP7 PE=1 SV=3
19	P55053	5.41e-47	150	135	0.523	0.511	FABP5_RAT Fatty acid-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Fabp5 PE=1 SV=3
20	Q01469	7.39e-46	147	135	0.508	0.496	FABP5_HUMAN Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03990 DUF348	3.4e+02	12.6	G5-linked-Ubiquitin-like domain
2	PF12345 DUF3641	2.8e+02	12.9	Protein of unknown function (DUF3641)
3	PF00061 Lipocalin	2.2e-20	84.8	Lipocalin / cytosolic fatty-acid binding protein family
4	PF14651 Lipocalin_7	0.0018	29.6	Lipocalin / cytosolic fatty-acid binding protein family
5	PF15743 SPATA1_C	1.3e+02	13.9	Spermatogenesis-associated C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368362

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244289	0.806	Hormone-sensitive lipase
2	9606.ENSP00000256104	0.655	Fatty acid-binding protein, adipocyte
3	9606.ENSP00000245206	0.633	Aspartate aminotransferase, mitochondrial
4	9606.ENSP00000377549	0.628	Gastrotropin
5	9606.ENSP00000432651	0.625	Smoothelin-like protein 1
6	9606.ENSP00000317165	0.616	Protein KRBA1
7	9606.ENSP00000421172	0.603	Acyl-CoA wax alcohol acyltransferase 2
8	9606.ENSP00000359022	0.580	Elongation of very long chain fatty acids protein 3
9	9606.ENSP00000295834	0.532	Fatty acid-binding protein, liver

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005504	1.000	fatty acid binding
GO:0005515	0.995	protein binding
GO:0036041	0.620	long-chain fatty acid binding
GO:0005501	0.329	retinoid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0008152	0.818	metabolic process
GO:0071704	0.763	organic substance metabolic process
GO:0044238	0.681	primary metabolic process
GO:0044237	0.631	cellular metabolic process
GO:0065007	0.559	biological regulation
GO:0071840	0.504	cellular component organization or biogenesis
GO:0016043	0.493	cellular component organization
GO:0050789	0.470	regulation of biological process
GO:0050794	0.369	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.978	cytosol
GO:0043227	0.947	membrane-bounded organelle
GO:0043229	0.926	intracellular organelle
GO:0043231	0.896	intracellular membrane-bounded organelle
GO:0005634	0.433	nucleus
GO:0012505	0.420	endomembrane system
GO:0031982	0.385	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]