StarFunc result for job id Q0ZGT2

User Input

>input (675 residues)
MNDISQKAEILLSSSKPVPKTYVPKLGKGDVKDKFEAMQRAREERNQRRSRDEKQRRKEQ
YIREREWNRRKQEIKEMLASDDEEDVSSKVEKAYVPKLTGTVKGRFAEMEKQRQEEQRKR
TEEERKRRIEQDMLEKRKIQRELAKRAEQIEDINNTGTESASEEGDDSLLITVVPVKSYK
TSGKMKKNFEDLEKEREEKERIKYEEDKRIRYEEQRPSLKEAKCLSLVMDDEIESEAKKE
SLSPGKLKLTFEELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAK
IFKGYRPGKLKLSFEEMERQRREDEKRKAEEEARRRIEEEKKAFAEARRNMVVDDDSPEM
YKTISQEFLTPGKLEINFEELLKQKMEEEKRRTEEERKHKLEMEKQEFEQLRQEMGEEEE
ENETFGLSREYEELIKLKRSGSIQAKNLKSKFEKIGQLSEKEIQKKIEEERARRRAIDLE
IKEREAENFHEEDDVDVRPARKSEAPFTHKVNMKARFEQMAKAREEEEQRRIEEQKLLRM
QFEQREIDAALQKKREEEEEEEGSIMNGSTAEDEEQTRSGAPWFKKPLKNTSVVDSEPVR
FTVKVTGEPKPEITWWFEGEILQDGEDYQYIERGETYCLYLPETFPEDGGEYMCKAVNNK
GSAASTCILTIESKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0ZGT2	1.000	1.000	4.647E-89	675	1.000	1.000	Q0ZGT2.pdb.gz	NEXN_HUMAN Nexilin OS=Homo sapiens OX=9606 GN=NEXN PE=1 SV=1
2	AFDB:Q9Z2J4	0.164	0.169	2.686E-70	656	0.810	0.834	Q9Z2J4.pdb.gz	NEXN_RAT Nexilin OS=Rattus norvegicus OX=10116 GN=Nexn PE=1 SV=1
3	AFDB:Q8SXC1	0.144	0.438	6.629E-14	218	0.074	0.229	Q8SXC1.pdb.gz	Q8SXC1_DROME GH09541p OS=Drosophila melanogaster OX=7227 GN=zormin PE=2 SV=1
4	AFDB:Q5DTJ9	0.141	0.073	1.298E-13	1315	0.105	0.054	Q5DTJ9.pdb.gz	MYPN_MOUSE Myopalladin OS=Mus musculus OX=10090 GN=Mypn PE=1 SV=2
5	AFDB:E9Q8Q6	0.141	0.062	3.900E-13	1531	0.043	0.019	E9Q8Q6.pdb.gz	CC141_MOUSE Coiled-coil domain-containing protein 141 OS=Mus musculus OX=10090 GN=Ccdc141 PE=1 SV=2
6	AFDB:D3ZEY0	0.141	0.063	4.146E-13	1530	0.043	0.019	D3ZEY0.pdb.gz	CC141_RAT Coiled-coil domain-containing protein 141 OS=Rattus norvegicus OX=10116 GN=Ccdc141 PE=1 SV=2
7	AFDB:Q90688	0.141	0.075	4.980E-13	1272	0.046	0.024	Q90688.pdb.gz	MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus OX=9031 GN=MYBPC3 PE=1 SV=3
8	AFDB:A1L1W0	0.141	0.182	9.752E-13	523	0.046	0.059	A1L1W0.pdb.gz
9	AFDB:A0A140LGX4	0.141	0.095	1.037E-12	1010	0.041	0.028	A0A140LGX4.pdb.gz
10	AFDB:B2RTX2	0.140	0.085	1.102E-12	1106	0.107	0.065	B2RTX2.pdb.gz	B2RTX2_HUMAN Palladin, cytoskeletal associated protein OS=Homo sapiens OX=9606 GN=PALLD PE=2 SV=1
11	PDB:4edqA	0.130	0.179	9.608E-8	483	0.030	0.041	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
12	PDB:6feyD	0.132	0.540	7.672E-7	160	0.031	0.131	6feyD.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
13	PDB:6feyB	0.135	0.431	9.216E-7	207	0.031	0.101	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
14	PDB:6dldD	0.111	0.265	1.414E-6	269	0.028	0.071	6dldD.pdb.gz
15	PDB:5c6wJ	0.116	0.309	1.805E-6	238	0.022	0.063	5c6wJ.pdb.gz
16	PDB:4aizA	0.118	0.658	2.305E-6	107	0.031	0.196	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
17	PDB:6sm1A	0.115	0.605	2.943E-6	111	0.019	0.117	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
18	PDB:5ir3A	0.124	0.665	3.325E-6	111	0.022	0.135	5ir3A.pdb.gz
19	PDB:6dlfA	0.118	0.326	3.325E-6	236	0.021	0.059	6dlfA.pdb.gz
20	PDB:8e4cC	0.110	0.479	3.994E-6	142	0.037	0.176	8e4cC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2BEV6	0.0	540	861	0.573	0.449	A2BEV6_DANRE Nexilin OS=Danio rerio OX=7955 GN=CH211-232D19.9 PE=4 SV=2
2	H7BXY5	0.0	1123	576	0.846	0.991	H7BXY5_HUMAN Nexilin F-actin binding protein (Fragment) OS=Homo sapiens OX=9606 GN=NEXN PE=1 SV=1
3	Q0ZGT2	0.0	1333	675	1.000	1.000	NEXN_HUMAN Nexilin OS=Homo sapiens OX=9606 GN=NEXN PE=1 SV=1
4	Q7TPW1	0.0	894	607	0.788	0.876	NEXN_MOUSE Nexilin OS=Mus musculus OX=10090 GN=Nexn PE=1 SV=3
5	Q9Z2J4	0.0	945	656	0.843	0.867	NEXN_RAT Nexilin OS=Rattus norvegicus OX=10116 GN=Nexn PE=1 SV=1
6	Q15746	4.70e-14	78.6	1914	0.052	0.018	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
7	Q6PDN3	1.51e-13	77.0	1941	0.050	0.018	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
8	G1U9Q7	2.21e-13	76.6	1903	0.055	0.019	G1U9Q7_MELGA Myosin light chain kinase, smooth muscle OS=Meleagris gallopavo OX=9103 GN=MYLK PE=3 SV=3
9	Q9W053	2.22e-13	76.6	2935	0.056	0.013	Q9W053_DROME Zormin, isoform F OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=4
10	Q7Z1Y4	2.32e-13	76.6	2935	0.056	0.013	Q7Z1Y4_DROME Zormin OS=Drosophila melanogaster OX=7227 GN=zormin PE=4 SV=1
11	Q0E8J4	2.79e-13	76.3	3079	0.056	0.012	Q0E8J4_DROME Zormin, isoform G OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
12	M9PE03	4.18e-13	75.9	3536	0.056	0.011	M9PE03_DROME Zormin, isoform E OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
13	Q0E8J3	4.34e-13	75.5	3640	0.056	0.010	Q0E8J3_DROME Zormin, isoform I OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
14	M9PBJ1	4.42e-13	75.5	3664	0.056	0.010	M9PBJ1_DROME Zormin, isoform J OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
15	Q0E8J5	3.00e-12	72.8	2960	0.044	0.010	Q0E8J5_DROME Zormin, isoform K OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
16	E9Q8Q6	3.48e-12	72.4	1531	0.049	0.022	CC141_MOUSE Coiled-coil domain-containing protein 141 OS=Mus musculus OX=10090 GN=Ccdc141 PE=1 SV=2
17	A2ASS6	9.71e-12	71.2	35213	0.050	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
18	A0A8I6A794	1.18e-11	70.9	5475	0.044	0.005	A0A8I6A794_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
19	D3ZEY0	1.27e-11	70.9	1530	0.049	0.022	CC141_RAT Coiled-coil domain-containing protein 141 OS=Rattus norvegicus OX=10116 GN=Ccdc141 PE=1 SV=2
20	B2RTX2	2.41e-11	69.7	1106	0.058	0.035	B2RTX2_HUMAN Palladin, cytoskeletal associated protein OS=Homo sapiens OX=9606 GN=PALLD PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	2e-12	58.3	Immunoglobulin I-set domain
2	PF00047 ig	0.003	29.0	Immunoglobulin domain
3	PF13895 Ig_2	1.4e+02	14.2	Immunoglobulin domain
4	PF13927 Ig_3	6.3e-06	38.0	Immunoglobulin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333938

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.965	Catenin beta-1
2	9606.ENSP00000053867	0.875	Granulins
3	9606.ENSP00000365745	0.783	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
4	9606.ENSP00000292385	0.776	Drebrin
5	9606.ENSP00000325785	0.677	Cytospin-A
6	9606.ENSP00000261503	0.666	Cytospin-B
7	9606.ENSP00000211998	0.653	Vinculin
8	9606.ENSP00000378400	0.651	LIM domain and actin-binding protein 1
9	9606.ENSP00000265748	0.646	Anillin
10	9606.ENSP00000362924	0.633	Gelsolin
11	9606.ENSP00000358866	0.631	Filamin-A
12	9606.ENSP00000362680	0.619	Proto-oncogene tyrosine-protein kinase Src
13	9606.ENSP00000375960	0.615	Afadin
14	9606.ENSP00000306997	0.595	Myozenin-2
15	9606.ENSP00000362935	0.588	Integrin beta-1-binding protein 2
16	9606.ENSP00000310375	0.579	Membrane protein MLC1
17	9606.ENSP00000401437	0.579	LIM domain-binding protein 3
18	9606.ENSP00000236918	0.573	Troponin T, cardiac muscle
19	9606.ENSP00000371194	0.571	Lymphocyte-specific protein 1
20	9606.ENSP00000247003	0.564	Probable ATP-dependent RNA helicase DDX49

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051015	1.000	actin filament binding
GO:0008307	0.998	structural constituent of muscle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0051128	0.851	regulation of cellular component organization
GO:0051493	0.840	regulation of cytoskeleton organization
GO:0040012	0.748	regulation of locomotion
GO:0009987	0.739	cellular process
GO:0050896	0.584	response to stimulus
GO:2000145	0.408	regulation of cell motility
GO:0048518	0.358	positive regulation of biological process
GO:0048522	0.313	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005886	0.998	plasma membrane
GO:0005737	0.996	cytoplasm
GO:0005856	0.977	cytoskeleton
GO:0015629	0.970	actin cytoskeleton
GO:0070161	0.962	anchoring junction
GO:0099080	0.957	supramolecular complex
GO:0005829	0.939	cytosol
GO:0005925	0.934	focal adhesion
GO:0099512	0.899	supramolecular fiber
GO:0043227	0.816	membrane-bounded organelle
GO:0043231	0.805	intracellular membrane-bounded organelle
GO:0030016	0.486	myofibril
GO:0031674	0.482	I band
GO:0070013	0.433	intracellular organelle lumen
GO:0031981	0.369	nuclear lumen
GO:0030018	0.369	Z disc

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]